Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR537 IGR540 IGR535 IGR534 IGR532 IGR536 IGR533 IGR538 IGR539 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 CPn0673 dacC, - CPn0672 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 CPn0673 dacC, - CPn0672 Type: tandem, Name:  - 10 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 ygo4, - CPn0680 CPn0673 dacC, - CPn0672
* Calculated from Protein Sequence

Gene ID: CPn0676

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
759217

Gene Stop:
758048

Gene Length:
1170

Molecular Weight*:
43391

pI*:
4.50

Net Charge*:
-23.93

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0676 is similar to CT695: residues 3-377 of CPn0676 are 23% similar to residues 5-384 of CT695, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
83
transmembrane  
141  
158
transmembrane  
179  
196

PDB Hit:


Gene Protein Sequence:
MGTPISGNDGDRNTISDPLEESAAEEGDSDLEDRVSESATQVIETIADTG
IPEATPSEGTNSDLNSDLVDRVEYEARGSLLTTMLARIRKAVSQIWMHVK
TKRHPKEQGVRSLGDIPCDLLKATRLPKETAEPPYFYALETALASCRSFF
FHVFLRLFTLLRRQHPEAPLDLCGTDPISPEAAVAFALILRSCCKWVATD
AVQEGLPLEVIEEAGMYNAFSLEATTTVEEVSKRLSELLYSDKRIDGLAN
VRGITKIITSPYLGAGQCVSVVDNLKTYDLGRNYTQVLACASQIDEFADK
GENEALVMKDILYLVRQDRSKELGDFLMMWSEEHASEVNYDVVLAILEVN
LPILEEDYRSHPLAYQKKLNYVICQFFCSERLTSIEPKD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAACTCCTATATCTGGCAATGATGGTGACCGTAATACGATATCAGA
TCCTTTAGAAGAAAGTGCCGCAGAAGAGGGGGATTCAGATTTAGAGGATC
GGGTATCGGAAAGTGCTACCCAAGTGATAGAAACCATAGCGGATACGGGG
ATCCCAGAAGCAACTCCATCTGAAGGTACGAATAGTGATTTAAATAGCGA
CCTTGTAGATAGAGTAGAATATGAAGCTCGCGGAAGCCTGTTAACTACGA
TGCTTGCGCGGATTCGTAAAGCAGTATCGCAGATTTGGATGCATGTTAAA
ACAAAACGCCATCCAAAAGAACAGGGAGTGCGTTCCTTGGGGGACATCCC
TTGTGATCTTCTCAAAGCAACGCGACTCCCTAAAGAAACTGCGGAACCTC
CATACTTTTATGCTTTAGAAACAGCACTAGCTTCATGCCGAAGCTTTTTC
TTTCATGTATTTTTAAGGCTATTCACTCTTTTACGTCGTCAACACCCAGA
GGCTCCTTTAGACCTTTGTGGTACAGATCCTATAAGTCCAGAAGCTGCAG
TTGCATTTGCTTTAATCTTACGTTCTTGCTGCAAGTGGGTAGCTACGGAC
GCAGTTCAAGAAGGACTGCCTTTAGAAGTCATCGAAGAGGCAGGAATGTA
TAATGCGTTTTCTTTAGAAGCTACAACAACAGTAGAAGAAGTCTCCAAAA
GGCTCTCCGAACTATTATACTCAGACAAACGTATTGATGGGTTAGCTAAC
GTCCGTGGGATTACTAAGATAATTACCTCTCCTTATTTAGGAGCTGGGCA
ATGCGTCAGCGTTGTTGACAACCTAAAAACATATGATCTTGGTCGTAACT
ATACTCAGGTACTTGCCTGTGCCTCCCAAATTGATGAGTTTGCCGATAAA
GGAGAGAACGAAGCTCTCGTTATGAAAGACATCCTCTATTTAGTACGTCA
AGATCGTAGCAAAGAGCTCGGAGACTTTTTAATGATGTGGTCAGAAGAGC
ACGCCTCAGAAGTAAACTATGATGTCGTTCTCGCTATCTTAGAAGTAAAT
CTCCCTATCTTAGAAGAAGACTATCGCTCGCATCCCCTAGCATATCAGAA
GAAATTAAACTATGTGATCTGTCAGTTTTTCTGTAGCGAGCGTCTGACAT
CAATAGAGCCCAAAGACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy