Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR531 IGR537 IGR535 IGR534 IGR532 IGR536 IGR533 IGR538 IGR539 CPn0671 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 CPn0673 CPn0669 dacC, - CPn0672 CPn0671 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 CPn0673 CPn0669 dacC, - CPn0672 Type: tandem, Name:  - 10 CPn0671 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 pgk, - CPn0679 CPn0673 dacC, - CPn0672 rsbW, - CPn0670 CPn0669 rsbW, - CPn0670
* Calculated from Protein Sequence

Gene ID: CPn0675

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
757919

Gene Stop:
756765

Gene Length:
1155

Molecular Weight*:
44230

pI*:
8.40

Net Charge*:
2.90

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0675 is orthologously related to CT696: residues 1-374 of CPn0675 are 37% similar to residues 12-387 of CT696, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MILDFQFSIGYYLRVLELAIRDGTRILAYDRKRLLLDAWPVNDPLPTNYD
TSVSTIRQVIHELFSWSAISYSISSRLLAIIELRLHEEKPQTGWLYRLFF
PSKYHIKKAIVDKLCMFKSLILFESKRPVDKIVQAANKVFSKGKSNFSSW
EDFTHEVTVSEVQTPLAGEVQRRLAADASLQMIIEALTTLLEGHTAYLPL
SLELLNQFIGEKAQPLKTLSEKSYVLLRELIQLFSLSAEDFQTIIMSIIS
DSLSEVLANSLIGNQPLTFHGKTFVGLWQETALASPEDSKLALGFLAEVL
RKVIVEKKLHVSKSDNTTPEEVGNIYSIRDQNPALWDKMITMLLMRWLLD
YDRDIGIALRKAAEYYNPHPSFWRQFLRLWQRRP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTTAGATTTTCAATTTTCTATAGGATATTATTTACGGGTTCTTGA
ACTAGCAATTAGGGATGGCACGCGCATACTCGCATATGACAGAAAACGAC
TTCTCTTAGATGCATGGCCGGTCAATGACCCCTTACCTACCAACTATGAT
ACAAGCGTATCCACGATTCGTCAGGTAATTCACGAGCTCTTTTCCTGGTC
AGCAATTTCTTATTCGATATCGAGTCGACTTTTAGCAATTATTGAATTGC
GTTTGCATGAAGAAAAACCCCAAACAGGATGGCTCTACCGGCTGTTCTTC
CCCTCCAAGTATCACATCAAAAAAGCCATTGTAGACAAACTATGTATGTT
TAAGTCTTTGATTCTTTTTGAGTCCAAGCGTCCTGTCGATAAAATTGTGC
AAGCTGCAAATAAGGTGTTCTCTAAAGGGAAAAGTAATTTTTCCTCATGG
GAAGATTTTACTCATGAGGTTACGGTATCAGAAGTTCAGACGCCTCTGGC
TGGAGAGGTGCAAAGAAGATTGGCAGCAGATGCCTCTCTACAAATGATCA
TAGAAGCGTTAACCACATTACTTGAAGGGCATACGGCGTATCTTCCCTTA
AGTTTAGAATTGCTCAACCAGTTTATAGGAGAAAAAGCGCAACCCCTAAA
AACATTATCAGAAAAGAGCTACGTATTGTTACGCGAGCTGATCCAGCTTT
TTTCTTTGAGTGCCGAGGATTTCCAAACGATTATTATGAGTATTATCTCA
GATTCTCTATCTGAGGTATTGGCAAACTCTCTTATTGGGAACCAGCCTTT
AACATTTCATGGGAAGACTTTTGTAGGTCTATGGCAAGAGACTGCCCTAG
CCTCCCCTGAAGATTCTAAATTAGCCCTGGGCTTTCTTGCAGAAGTATTG
CGGAAAGTCATCGTAGAAAAGAAACTCCATGTATCTAAGTCCGACAATAC
CACTCCTGAGGAGGTGGGGAATATTTATAGTATTCGAGACCAAAATCCCG
CCCTGTGGGATAAAATGATTACCATGTTACTTATGCGTTGGTTGTTAGAC
TATGATAGAGATATCGGTATAGCCTTAAGAAAAGCAGCGGAATACTATAA
TCCGCATCCTTCTTTTTGGAGACAATTCTTGAGATTATGGCAACGTCGTC
CGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy