Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR531 IGR530 IGR537 IGR535 IGR534 IGR532 IGR536 IGR529 IGR533 IGR538 CPn0671 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 CPn0671 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 Type: tandem, Name:  - 10 CPn0671 CPn0678 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 CPn0673 CPn0668 dacC, - CPn0672 rsbW, - CPn0670 CPn0669 rsbW, - CPn0670
* Calculated from Protein Sequence

Gene ID: CPn0674

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fmu  

Definition:
FMU/SUN-related methyltransferase

Gene Start:
756668

Gene Stop:
755574

Gene Length:
1095

Molecular Weight*:
41529

pI*:
10.00

Net Charge*:
12.48

EC:
 

Functional Class:
translation  

Pathway: pathway table

Comment:
rRNA methyltransferase, through similarity, belongs to the Fmu (SUN)
(bacterial)/nucleolar protein Nol1/Nop2 (eukaryotes) family.
It is a RNA methyltransferase.

Blast Summary:  PSI-Blast Search
CPn0674 is orthologously related to CT553: residues 64-361 of CPn0674 are 59% similar to residues 21-319 of CT553, a predicted FMU/SUN-related methyltransferase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0144
COG name: Predicted rRNA methylase
Functional Class:  J
The phylogenetic pattern of COG0144 is Am-KY-vcEbrh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search
Residues 174-332 are 29% similar to a FMU P120 nucleolar protein domain (see PD003196), from PYROCOCCUS HORIKOSHII, O58805_PYRHO.

Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 121 to 362 (E-value = 7.9e-13) place CPn0674 in the Nol1_Nop2_Sun family which is described as NOL1/NOP2/sun family (PF01189)

PDB Hit:


Gene Protein Sequence:
MVPFRQHHAYQLLKQLHTSAISEADRVSYYFKQNRSLGSKDRQWIQNIIF
NILRHRRLLETLILDSGEQVTPEALVAKVNEGVLENLDSYSAIPWPVRYS
ISDDLAHFLVQDYGEEQAEEIAKIWLTEAPITIRVNTDKISVKELQEKLE
YPSSPGELPEALHFSKRHPLQSTEAFRRGFFEIQDENSQRISQGISLTDK
DIVLDFCAGAGGKSLIFAQKAKHVVINDSRKAILQTAKHRLLRAGARNFS
LADQLRLGSFSVVIVDAPCSGTGVFRRHPEHKWQFSKKLLLNYVRVQKSI
LKQASAYVGPRGRLVYITCSLLKEENEAHVAYMHSLGWKEVHRKTLPLQV
GKGDAFFTSHFQKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTCCTTTTCGTCAGCATCATGCTTATCAGCTGTTAAAACAGCTACA
CACGTCTGCAATTTCAGAAGCAGATAGAGTTTCGTACTATTTTAAACAAA
ACCGTTCTTTGGGGTCTAAGGATCGTCAGTGGATTCAAAATATTATTTTT
AATATTTTGCGTCATCGCCGTCTTCTTGAAACTTTAATTCTTGATTCGGG
AGAACAAGTAACTCCAGAAGCTCTCGTTGCGAAAGTAAACGAAGGGGTTC
TAGAGAACTTGGACAGTTACAGCGCTATTCCCTGGCCTGTGCGTTACTCT
ATATCTGATGATCTTGCGCACTTCTTAGTTCAAGATTATGGAGAAGAACA
GGCCGAGGAGATCGCCAAGATTTGGTTAACGGAAGCTCCGATTACGATTC
GTGTGAATACAGATAAAATCTCCGTCAAAGAACTCCAAGAGAAGTTAGAA
TATCCAAGTTCTCCTGGAGAGCTTCCTGAGGCATTGCACTTTTCCAAACG
TCATCCCTTACAATCTACAGAAGCATTTCGTCGTGGGTTTTTCGAAATCC
AAGATGAAAACTCTCAGAGAATTTCTCAGGGCATTTCCCTAACAGATAAA
GATATCGTCTTGGATTTTTGTGCAGGAGCAGGCGGGAAAAGCCTTATCTT
TGCGCAGAAAGCAAAACATGTTGTGATCAATGACAGTCGTAAAGCTATTT
TGCAAACTGCAAAGCATCGTTTATTACGTGCTGGAGCTAGGAATTTTTCT
TTAGCGGATCAATTACGTTTAGGATCCTTTTCTGTAGTTATCGTAGACGC
TCCTTGTTCTGGAACGGGAGTTTTCCGACGACATCCCGAACATAAGTGGC
AATTTTCTAAGAAATTGTTGTTGAACTATGTGCGAGTGCAAAAGAGCATC
TTAAAACAAGCAAGTGCTTATGTGGGACCTCGGGGACGACTTGTCTACAT
TACCTGTTCTCTTTTAAAAGAAGAAAATGAGGCTCATGTTGCCTACATGC
ACTCTTTAGGTTGGAAAGAAGTCCACAGAAAAACGCTTCCCTTACAAGTA
GGTAAGGGCGACGCATTTTTTACTTCTCATTTTCAAAAAATCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy