Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR531 IGR530 IGR537 IGR528 IGR535 IGR534 IGR532 IGR536 IGR529 IGR533 CPn0671 CPn0667 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 dnaE, - CPn0666 CPn0671 CPn0667 fmu, - CPn0674 CPn0677 CPn0675 CPn0676 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 dnaE, - CPn0666 CPn0671 CPn0667 fmu, - CPn0674 CPn0675 CPn0676 CPn0677 CPn0673 CPn0668 dacC, - CPn0672 dnaE, - CPn0666 rsbW, - CPn0670 CPn0669 rsbW, - CPn0670
* Calculated from Protein Sequence

Gene ID: CPn0672

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dacC  

Definition:
D-alanyl-D-alanine carboxypeptidase (penicillin binding protein 6)

Gene Start:
753741

Gene Stop:
755051

Gene Length:
1311

Molecular Weight*:
49141

pI*:
8.70

Net Charge*:
12.82

EC:
3.4.16.4  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
D-Ala-D-Ala Carboxypeptidase

Secondary Evidence:
BROOME-SMITH J.K., IOANNIDIS I., EDELMAN A., SPRATT B.G. 1988. "Nucleotide sequences of the penicillin-binding protein 5 and 6 genes of Escherichia coli." NUCLEIC ACIDS RES. 16:1617-1617.


Comment:
In E. coli, D-Ala-D-Ala Carboxypeptidase removes the C-terminal D-alanyl residues from sugar-peptide cell wall precursors.
This enzyme is involved in the final stages of peptidoglycan synthesis.
It is believed to be located in the inner membrane with its N-terminal in the periplasmic space.
Through similarity, DacC belongs to the peptidase family S11; also, known as the D-Alanyl-D-Alanine carboxypeptidase I family.

Blast Summary:  PSI-Blast Search
CPn0672 is orthologously related to CT551: residues 19-341 of CPn0672 are 61% similar to residues 20-340 of CT551, a predicted D-Ala-D-Ala carboxypeptidase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1686
COG name: D-alanyl-D-alanine carboxypeptidase
Functional Class:  M
The phylogenetic pattern of COG1686 is --------EBRH----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 22 to 281 (E-value = 1.7e-21) place CPn0672 in the Peptidase_S11 family which is described as D-alanyl-D-alanine carboxypeptidase (PF00768)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
7  
24
transmembrane  
59  
77
transmembrane  
132  
149
transmembrane  
402  
419

PDB Hit:


Gene Protein Sequence:
MKRPFFTYLCIIFYGSCASLSLHAGLSFPEVRGATAAVVHADSGKVFYDK
DIDAVIYPASMTKIATALFILKHYPTVLDTLIKVKQDAIASITPQAKKQS
GYRSPPHWLETDGSTIQLHLREELLGWDLFHALLVCSANDAANVLAMACC
GSVEKFMDKLNFFLKEEIGCTHTHFNNPHGLHHPNHYTTTRDLISIMRCA
LKEPPFRGVISTTSYKIGATNLHGERILSPTNKLLLPGSTYHYPPALGGK
TGTTKTAGKNLIMAAEKNNRLLVTIATGYSGPVSDLYQDVIALCETVFNE
PLLRKELVPPSDCLQLEIANLGKLSCPLPEGLYYDFYASEDREPLSVSFI
AHADAFPIEQGDLLGHWVFYDDEGKKISSQPFYAPCRFERTIKPWKLYMK
RVFTSYRTYMSITMLLMYFRIRKHRKYKNLKHYSKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGACCTTTTTTTACCTATCTATGCATCATCTTCTACGGATCTTG
TGCATCGTTATCTTTACATGCAGGACTCTCTTTCCCAGAAGTACGTGGAG
CTACGGCTGCTGTTGTCCATGCCGACTCTGGGAAGGTATTCTATGATAAA
GACATAGATGCTGTAATCTATCCTGCCAGCATGACGAAAATCGCAACTGC
CCTCTTTATCCTAAAGCACTATCCCACAGTCCTCGATACTCTCATCAAAG
TCAAACAAGATGCGATCGCTTCCATCACTCCGCAAGCAAAAAAACAATCA
GGATATCGTAGTCCTCCCCACTGGTTAGAAACTGATGGATCTACAATACA
GCTCCATCTTCGAGAAGAGCTTTTAGGGTGGGACCTGTTCCACGCCTTAC
TGGTCTGTTCTGCTAATGATGCTGCGAATGTCTTAGCTATGGCATGTTGC
GGATCTGTAGAGAAGTTTATGGATAAGCTGAACTTCTTCTTAAAAGAAGA
AATCGGCTGCACTCATACCCATTTTAATAATCCCCATGGGTTACATCATC
CGAATCACTATACTACAACCCGTGATCTTATTAGCATCATGCGTTGCGCT
CTGAAAGAACCTCCATTTCGAGGGGTCATCTCCACGACAAGCTATAAAAT
AGGGGCTACAAACCTGCATGGCGAACGGATCCTATCCCCAACAAACAAAT
TGCTTCTTCCTGGGTCTACCTACCACTATCCCCCAGCTTTAGGAGGGAAA
ACAGGGACCACCAAGACTGCAGGGAAAAATCTAATTATGGCTGCTGAAAA
AAATAACCGCCTCTTGGTAACGATCGCAACGGGCTATTCGGGTCCTGTGA
GTGATCTCTACCAAGATGTCATTGCTCTATGTGAAACGGTATTTAACGAG
CCGCTATTAAGAAAAGAGCTCGTCCCCCCCTCCGACTGTCTCCAATTAGA
AATAGCGAATCTTGGGAAGCTTTCTTGCCCTCTTCCTGAGGGACTCTACT
ATGACTTCTATGCCTCCGAAGATCGCGAACCTCTTTCTGTATCTTTTATT
GCACATGCGGACGCCTTCCCTATTGAACAAGGAGATCTTCTTGGTCATTG
GGTTTTTTATGACGATGAAGGCAAGAAAATTTCTTCCCAGCCTTTCTATG
CCCCTTGTCGTTTTGAGCGCACTATCAAGCCTTGGAAACTCTATATGAAA
CGTGTCTTCACATCGTATAGAACCTATATGTCTATAACCATGCTGCTCAT
GTATTTTCGCATCCGCAAGCACCGCAAGTATAAAAATTTAAAACACTATT
CTAAAATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy