Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR531 IGR530 IGR528 IGR535 IGR534 IGR532 IGR536 IGR529 IGR533 CPn0671 CPn0667 fmu, - CPn0674 CPn0675 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 dnaE, - CPn0666 CPn0671 CPn0667 fmu, - CPn0674 CPn0675 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 dnaE, - CPn0666 CPn0671 CPn0667 fmu, - CPn0674 CPn0675 CPn0673 CPn0668 dacC, - CPn0672 dnaE, - CPn0666 rsbW, - CPn0670 CPn0669 rsbW, - CPn0670
* Calculated from Protein Sequence

Gene ID: CPn0670

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rsbW  

Definition:
conserved hypothetical protein (possible sigma regulatory factor - histidine kinase)

Gene Start:
752765

Gene Stop:
753199

Gene Length:
435

Molecular Weight*:
15975

pI*:
5.60

Net Charge*:
-4.75

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0670 is orthologously related to CT549: residues 1-144 of CPn0670 are 55% similar to residues 1-145 of CT549, a conserved hypothetical protein.


COGS Summary:  COGS Search
BeTs to 3 clades of COG2172
COG name: Anti-sigma regulatory factor (Ser/Thr protein kinase)
Functional Class:  T
The phylogenetic pattern of COG2172 is ------v--Br-------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MTFFEGETVFPAVLSELHSMLDLIKRAGKQSKCPQEKLLKLELACEELLV
NIISYAYQGENSPGTIAISCISHRGDLEVVIKDHGPSFNPLAVSINIQED
LPLEQRKLGGLGIFLAKSSVDEFLYAREDHCNIVHLKMLNGQHS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCTTTTTTGAAGGAGAAACCGTTTTTCCTGCAGTACTTAGTGAACT
TCATAGCATGTTGGACTTAATCAAACGTGCAGGAAAACAATCTAAGTGCC
CCCAAGAGAAGTTGTTAAAGCTCGAGCTTGCTTGTGAGGAGCTTCTCGTC
AATATCATTTCTTATGCTTATCAGGGCGAAAATTCTCCAGGAACGATTGC
GATTTCTTGCATCTCCCATAGAGGAGACTTAGAAGTTGTGATTAAAGACC
ATGGACCTTCTTTCAATCCTCTTGCTGTTTCAATCAACATTCAGGAAGAT
CTTCCCTTAGAACAGCGTAAACTCGGGGGCTTAGGGATTTTTCTGGCTAA
AAGTTCTGTGGACGAGTTTCTTTATGCTCGTGAAGATCATTGCAATATTG
TGCATTTAAAAATGCTCAATGGCCAACATTCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy