Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR531 IGR530 IGR527 IGR528 IGR534 IGR532 IGR529 IGR533 CPn0671 CPn0667 fmu, - CPn0674 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 uhpC, - CPn0665 dnaE, - CPn0666 CPn0671 CPn0667 fmu, - CPn0674 CPn0673 CPn0669 CPn0668 dacC, - CPn0672 uhpC, - CPn0665 dnaE, - CPn0666 CPn0671 CPn0667 fmu, - CPn0674 CPn0673 CPn0668 dacC, - CPn0672 uhpC, - CPn0665 dnaE, - CPn0666 rsbW, - CPn0670 CPn0669 rsbW, - CPn0670
* Calculated from Protein Sequence

Gene ID: CPn0667

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
751058

Gene Stop:
750174

Gene Length:
885

Molecular Weight*:
33471

pI*:
10.10

Net Charge*:
14.08

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0667 is orthologously related to CT546: residues 1-291 of CPn0667 are 55% similar to residues 1-281 of CT546, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
6  
23
transmembrane  
252  
269

PDB Hit:


Gene Protein Sequence:
MKKLILYFAAFVASLFCGVFLWDRVPCAQKIMRLAADHSSEVFSKSCRFV
RKISGFEELQVFERHVSPEQALALFPEYRDGKSFVELAFIPHTLMHVRFS
KEEPVKKHIISQEGEILWSLVNGEMVLHTGTWTCSKGFRECLLLHAGKQD
MRVIQTLATLGGTTSRESLAQALALKNIRAERVIKECQKKKLIFASGNQI
GTHFQQFQPIRGCTTTLNNNPVWLQKPRHAAVFPAQYSEDRVRHLVKMIF
GDNFLIVRSSMVYVPVYKISLVSADNSVRVEYINAVTGKSFQDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAGTTAATTCTATATTTTGCTGCTTTTGTTGCTTCTCTTTTTTG
TGGTGTTTTTTTGTGGGATCGAGTTCCTTGTGCACAAAAAATTATGCGGC
TTGCTGCTGACCATAGCTCAGAAGTATTTTCTAAGAGCTGCCGCTTTGTA
CGAAAAATCTCAGGATTTGAAGAGTTACAAGTTTTTGAACGTCACGTCTC
TCCAGAACAGGCGTTGGCATTGTTCCCAGAATATCGTGATGGCAAGTCTT
TTGTAGAGCTCGCCTTCATCCCACATACCCTTATGCACGTACGCTTCTCT
AAAGAAGAACCTGTCAAAAAGCATATTATCAGCCAAGAGGGAGAAATCCT
TTGGAGCTTAGTTAATGGTGAGATGGTATTGCATACAGGGACTTGGACAT
GCTCTAAGGGATTTCGAGAGTGCCTCCTTTTGCACGCTGGTAAGCAAGAT
ATGCGGGTGATACAAACGCTAGCTACCTTAGGGGGAACCACATCCCGGGA
ATCCTTAGCCCAAGCCTTAGCCCTAAAGAATATCCGTGCAGAGCGAGTAA
TTAAGGAATGTCAGAAGAAAAAACTGATCTTTGCCTCCGGGAATCAAATA
GGAACGCACTTCCAACAGTTCCAGCCTATCCGAGGGTGTACAACAACACT
CAATAACAATCCTGTGTGGTTGCAAAAACCACGTCACGCAGCCGTGTTCC
CTGCGCAGTATTCCGAAGATCGTGTGCGTCATTTAGTGAAGATGATCTTT
GGAGATAATTTTTTAATTGTACGTAGCTCGATGGTCTATGTACCTGTCTA
TAAGATCTCCCTAGTTTCTGCAGATAATAGTGTCCGTGTTGAATACATCA
ACGCAGTCACGGGAAAATCTTTTCAAGATCTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy