Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR531 IGR530 IGR527 IGR528 IGR529 IGR526 IGR525 CPn0664 CPn0671 CPn0667 hisS, - CPn0663 CPn0669 CPn0668 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 CPn0671 CPn0667 hisS, - CPn0663 CPn0669 CPn0668 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 CPn0671 CPn0667 hisS, - CPn0663 CPn0668 uhpC, - CPn0665 dnaE, - CPn0666 rsbW, - CPn0670 CPn0669 rsbW, - CPn0670
* Calculated from Protein Sequence

Gene ID: CPn0666

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaE  

Definition:
DNA polymerase III alpha chain

Gene Start:
746388

Gene Stop:
750110

Gene Length:
3723

Molecular Weight*:
140060

pI*:
6.40

Net Charge*:
-12.80

EC:
 2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism
ucleotide Metabolism; Purine metabolism

Comment:
The alpha chain is responsible for the
polymerase activity of the multichain
enzyme. Other subunits perform 3' to 5'
exonucleolytic activity. See
CPn0274 and CPn0040 for gamma and tau chain
sequences. See CPn0338 for a beta chain sequence.

Blast Summary:  PSI-Blast Search
CPn0666 is similar to TP0669 in T. pallidum, UU415 in U. urealyticum and MG261 and MG031 in M. genitalium. They are all predicted DNA polymerase III alpha subunits.

CPn0666 is orthologously related to CT545 and
they share 70% similarity.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0587
COG name: DNA-dependent DNA polymerase III alpha chain
Functional Class:  L
The phylogenetic pattern of COG0587 is -----qvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 69 (E-value = 5.5e-34) place CPn0666 in the PHP_N family which is described as PHP domain N-terminal region (PF02231)
Residues 85 to 235 (E-value = 3.6e-39) place CPn0666 in the PHP_C family which is described as PHP domain C-terminal region (PF02811)

PDB Hit:


Gene Protein Sequence:
LTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLYGAVDF
YKECTQKGIQPIIGCECYIAPGSRFDKKKEKRSRAAHHLILLCKNEQGYR
NLCILTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKS
PEALLLELQWFQDLFKDDYFTEVQLHKMSEESIAGFKEEWLKQEYYSLIE
KQIKVNTAVLEASKRLGIPTVATNDIHYINANDWQAHEILLNVQSGETVR
IAKQNTHIPNPKRKVYRSREYYFKSPAQMAELFKDIPEVISNTLEVAKRC
DFTFDFSKKHYPIYVPESLKTLNSYTEEDRYQASAVFLKQLAEEALPKKY
SSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDYLLIVWDIIHW
AKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYP
DIDIDICMAGRERVINYAIERHGKDNVAQIITFGTMKAKMAVKDVGRTLD
MALSKVNHIAKHIPDLNTTLSKALETDPDLHQLYINDAESAQVIDMALCL
EGSIRNTGVHAAGVIICGDQLTNHIPICISKDSTMITTQYSMKPVESVGM
LKVDLLGLKTLTSINIAMSAIEKKTGQSLAMATLPLDDATTFSLLHQGKT
MGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSFINRKHG
KEIIEYDHPLMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAM
GKKDFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKFAAYGFNKSHAA
AYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPIL
PPHINVSSNHFVATDEGIRFAMGAIKGIGRGLIESIVEERDHHGPYESIR
DFIQRSDLKKVSKKSIESLIDAGCFDCFDSNRDLLLASVEPLYEAIAKDK
KEAASGVMTFFTLGAMDRKNEVPICLPKDIPTRSKKELLKKEKELLGIYL
TEHPMDTVRDHLSRLSVVLAGEFENLPHGSVVRTVFIIDKVTTKISSKAQ
KKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSL
RISCRWMKDLSIVNENIIYECDQAFDRIKNQVQKMSFTMSTSGKETKAKG
NKPNENGHTQALAPVTLSLDLNELRHSHLCILKKIVQKHPGSRTLVLVFT
QDNERVASMSPDDAYFVCEDIEELRQELVTADLPVRVITV$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACCTGGATACCCCTTCACTGTCATTCTCAATACTCTGTTCTTGATGC
AATGAGCTCCATCAAAGATTTCGTTGCGAAAGGTCAGGAATTTGGAATTC
CCGCTCTGGCTCTAACAGACCATGGGAATCTTTATGGAGCTGTTGATTTC
TATAAAGAATGCACTCAAAAAGGGATCCAACCCATCATTGGTTGCGAGTG
TTATATTGCTCCAGGATCACGTTTCGATAAGAAAAAAGAGAAGCGTAGTC
GTGCAGCACACCATCTCATTTTATTATGTAAAAATGAACAAGGGTACCGC
AACCTTTGTATTTTAACCTCCCTAGCATTTACTGAGGGTTTCTATTACTT
TCCTCGGATAGACAAGGATCTTTTGAGACAGTACTCTGAAGGCTTAATCT
GTTTATCTGGTTGTTTATCTAGTTCTGTTTCAGATGCTGCCTTAAAATCT
CCGGAAGCTCTGCTTCTTGAATTGCAATGGTTTCAAGACCTATTCAAAGA
TGATTATTTCACAGAAGTACAACTACACAAGATGTCCGAAGAGAGCATTG
CAGGCTTTAAAGAGGAATGGTTAAAGCAAGAATATTACTCTCTCATTGAA
AAACAGATCAAAGTCAATACTGCAGTGTTAGAAGCAAGTAAGCGCTTAGG
CATTCCTACTGTAGCTACGAATGACATCCATTACATCAATGCAAACGATT
GGCAAGCTCATGAAATCCTGTTGAATGTCCAATCTGGGGAGACTGTGCGG
ATTGCGAAACAGAATACTCATATCCCCAATCCTAAACGAAAGGTCTATCG
CAGTCGCGAGTACTATTTTAAATCCCCTGCGCAAATGGCAGAGTTATTTA
AAGATATTCCTGAGGTCATTTCCAACACATTAGAAGTTGCCAAACGGTGT
GATTTTACTTTTGATTTTTCCAAGAAACACTACCCTATCTATGTCCCTGA
ATCTTTAAAAACCTTAAACAGCTACACGGAGGAAGACCGTTATCAAGCTT
CTGCAGTCTTCTTAAAACAGCTAGCTGAAGAAGCTTTGCCTAAGAAATAC
TCTTCTGAAGTTCTTGCTCATATTGCTAAGAAATTTCCACATCGGGACCC
TATCGATATTGTCAAAGAAAGGATGGACATGGAGATGGCCATCATCATTC
CTAAAGGAATGTGTGACTATCTTTTGATTGTTTGGGACATTATTCATTGG
GCCAAAGCAAATGGCATTCCTGTAGGCCCTGGAAGAGGTTCAGGAGCTGG
ATCCGTATTACTATTTTTGTTAGGGATCACAGAAATCGAGCCCATACGAT
TTGATTTATTCTTTGAGAGATTTATCAATCCTGAGCGTTTGTCTTACCCA
GATATTGACATCGATATTTGCATGGCAGGACGTGAACGTGTCATTAATTA
TGCAATTGAGCGTCATGGCAAAGATAATGTAGCTCAAATCATTACTTTTG
GAACTATGAAAGCCAAAATGGCTGTCAAAGATGTGGGAAGAACTTTAGAC
ATGGCCTTATCTAAAGTGAACCACATTGCGAAACATATTCCAGATTTAAA
TACTACGTTGTCTAAAGCTTTAGAAACAGATCCTGACCTACATCAGCTCT
ATATTAACGATGCCGAATCTGCACAAGTGATTGATATGGCGCTTTGCTTA
GAAGGCTCCATACGGAATACAGGGGTTCATGCTGCTGGTGTGATTATCTG
TGGAGACCAGCTGACCAATCACATTCCGATTTGTATTTCTAAAGACTCCA
CAATGATTACAACACAATACTCTATGAAACCCGTGGAGAGTGTTGGAATG
CTTAAAGTCGACTTATTAGGGCTCAAGACTTTAACCAGTATCAATATTGC
AATGTCTGCAATTGAAAAGAAAACAGGACAATCGCTAGCTATGGCGACAC
TGCCTTTGGATGATGCCACCACATTTTCTCTTTTACATCAGGGAAAGACT
ATGGGGATATTTCAAATGGAATCCAAGGGGATGCAAGAATTAGCAAAAAA
CCTACGCCCTGACCTCTTTGAGGAAATCATTGCTATGGGTGCTTTATACC
GCCCAGGCCCTATGGATATGATTCCTTCTTTTATTAACCGCAAGCATGGC
AAAGAAATTATAGAATACGACCATCCCCTTATGGAATCCATTCTTAAGGA
AACCTATGGAATTATGGTCTACCAAGAGCAAGTCATGCAGATTGCTGGTG
CATTAGCTAGTTATTCTCTTGGAGAAGGTGATGTATTACGACGTGCCATG
GGGAAGAAAGACTTCCAACAGATGGAGCAGGAGCGCGAAAAGTTCTGTAA
ACGCGCCTGCAATAACGGCATAGATCCTGAGTTAGCGACTGTCATCTTTG
ATAAGATGGAAAAATTTGCTGCCTACGGCTTTAACAAATCTCATGCTGCT
GCCTATGGCTTGATTACTTATACAACGGCGTATCTCAAAGCAAATTATCC
TAAAGAGTGGCTTGCGGCCTTACTTACCTGTGATTCTGACGATATTGAGA
AGATAGGAAAACTGATTCGAGAAGCTCAGAGTATGGGCATTCCGATTCTT
CCTCCTCATATCAATGTCTCTAGCAATCACTTTGTAGCTACTGATGAAGG
CATACGCTTTGCGATGGGAGCTATTAAAGGGATTGGGCGTGGTTTAATTG
AGAGCATTGTAGAAGAGAGAGATCATCATGGTCCTTATGAGAGCATCCGC
GACTTTATCCAGAGGTCTGATTTAAAAAAAGTTTCGAAAAAAAGTATAGA
AAGTTTAATCGATGCGGGTTGTTTTGATTGCTTTGATTCTAACCGAGATT
TGCTGTTAGCCTCTGTAGAGCCCCTCTATGAAGCTATTGCCAAAGACAAG
AAAGAGGCTGCATCTGGTGTGATGACGTTCTTTACTTTAGGAGCTATGGA
TCGAAAAAATGAAGTCCCCATTTGTCTTCCTAAAGACATTCCGACTCGCT
CTAAGAAAGAACTTTTAAAAAAAGAAAAAGAGCTCTTAGGGATTTACCTT
ACAGAGCACCCTATGGATACCGTGCGAGATCATCTTTCTCGTCTTTCTGT
AGTTCTTGCTGGAGAATTTGAAAATCTCCCGCATGGTTCTGTAGTCCGCA
CCGTGTTTATTATTGATAAAGTAACGACTAAAATTTCATCAAAAGCGCAA
AAGAAGTTTGCTGTCCTTCGTGTTAGTGATGGCATCGATTCTTATGAACT
GCCGATCTGGCCAGATATGTATGAAGAACAACAAGAACTTCTAGAAGAAG
ATCGTCTTATCTATGCTATTCTTGTTTTAGATAAGCGCAGTGATTCTCTA
CGTATTTCTTGTCGCTGGATGAAAGATCTTTCTATTGTTAATGAAAACAT
CATTTATGAGTGTGATCAAGCTTTTGATAGAATAAAAAATCAGGTGCAAA
AAATGTCATTTACAATGTCAACCTCTGGCAAAGAAACTAAAGCTAAAGGG
AATAAGCCTAATGAGAATGGGCATACACAAGCTTTAGCTCCTGTGACTCT
ATCTTTAGATCTCAATGAACTCCGTCATAGTCATCTATGTATCTTAAAGA
AGATTGTGCAAAAGCACCCTGGCTCACGGACATTAGTTTTAGTTTTTACT
CAAGATAACGAAAGAGTTGCCTCGATGTCTCCTGACGACGCGTATTTCGT
TTGTGAAGATATTGAAGAACTCCGTCAAGAACTTGTGACTGCAGACCTTC
CTGTGCGTGTAATTACTGTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy