Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR527 IGR528 IGR524 IGR526 IGR525 CPn0664 mip, - CPn0661 CPn0667 aspS, - CPn0662 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 mip, - CPn0661 CPn0667 aspS, - CPn0662 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 mip, - CPn0661 CPn0667 aspS, - CPn0662 hisS, - CPn0663 hisS, - CPn0663 uhpC, - CPn0665 dnaE, - CPn0666
* Calculated from Protein Sequence

Gene ID: CPn0665

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uhpC  

Definition:
hexose phosphate transport system regulatory protein (UHPC-related)

Gene Start:
745001

Gene Stop:
746368

Gene Length:
1368

Molecular Weight*:
51649

pI*:
10.20

Net Charge*:
15.22

EC:
 

Functional Class:
transport and binding proteins; carbohydrates, organic alcohols and acids  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0665 orthologously related to CT544: residues 1-452 of CPn0665 are 79% similar to residues 1- 452 of CT544, a predicted hexose phosphate transport system regulatory protein from C. trachomatis.
Other significant hits in gapped BLAST to regulatory UhpC protein sequences; e.g. residues 7-446 are 45% similar to UHPC_SALTY; residues 7-446 are 44% similar to UHPC_ECOLI; and residues 8-449 are 40% similar to GLPT_BACSU.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0477
COG name: Permeases
Functional Class: G,E,R
The phylogenetic pattern of COG0477 is AMTKYQVCEBRHUJGPo-INX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 38-407 span seven regions of similarity to blocks BL00942A-G (glpT family of transporters proteins) with a combined E-value of 7.5e-105.

ProDom Summary:  Protein Domain Search
Residues 27-128 are 48% similar to a defined domain of UHPC_ECOLI, defined as: TRANSPORT TRANSMEMBRANE INNER MEMBRANE TRANSPORTER G-3-P SUGAR PROTEIN GLYCEROL-3-PHOSPHATE PERMEASE.
Residues 130-212 are 56% similar to a defined domain of UHPC_SALTY, defined as: PROTEIN TRANSPORT TRANSMEMBRANE TRANSPORTER RESISTANCE MEMBRANE SUGAR INNER REGION INTERGENIC.

Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
34  
51
transmembrane  
68  
85
transmembrane  
105  
125
transmembrane  
167  
184
transmembrane  
189  
206
transmembrane  
259  
280
transmembrane  
303  
320
transmembrane  
335  
352
transmembrane  
363  
380
transmembrane  
396  
413
transmembrane  
423  
441

PDB Hit:


Gene Protein Sequence:
MNVWTKFFQPPKHIKEIEDQEVVKKKYKYWRIRIFYSMFIGYIFYYFTRK
SFTFAMPTLIADLGFDKAQLGIIGSTLYFSYGISKFVSGVMSDQSNPRYF
MAIGLMITGLTNIFFGMSSSIVLFALWWGLNGWFQGWGWPPCARLLTHWY
AKSERGTWWSVWSTSHNIGGALIPILTGFIIDYSGWRGAMYVPGILCIGM
GLVLINRLRDTPQSLGLPPIEKYKRDPHHAHHEGKSASEGTEEIERELST
REILFTYVLTNQWLWFLAAASFFIYIVRMAVNDWSALFLIETKHYAAVKA
NFCVSLFEIGGLFGMLVAGWLSDKISKGNRGPMNVLFSLGLLFAILGMWF
SRSHNQWWVDGTLLFVIGFFLYGPQMMIGLAAAELSHKKAAGTASGFTGW
FAYFGATFAGYPLGKVTDVWGWKGFFIALLACASIALLLFLPTWNATEKN
TRSKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGTTTGGACTAAATTTTTCCAACCTCCAAAGCACATTAAAGAAAT
TGAAGACCAAGAAGTGGTCAAGAAAAAATACAAATACTGGCGTATTCGTA
TTTTCTATAGCATGTTCATCGGCTACATTTTCTATTATTTCACAAGAAAA
AGCTTTACCTTTGCGATGCCCACGCTAATTGCTGATTTGGGTTTTGATAA
AGCGCAATTAGGGATCATAGGAAGTACCTTATATTTTTCTTATGGAATCA
GTAAGTTTGTTAGCGGAGTCATGTCCGACCAATCCAATCCTAGATATTTC
ATGGCTATAGGATTGATGATTACAGGGCTCACTAACATCTTTTTCGGGAT
GTCATCCTCTATTGTATTATTTGCTCTTTGGTGGGGACTAAACGGATGGT
TCCAAGGGTGGGGCTGGCCTCCATGTGCTCGTCTACTCACCCACTGGTAT
GCGAAATCAGAACGGGGCACTTGGTGGAGTGTGTGGAGTACCTCCCACAA
TATTGGGGGAGCACTTATTCCTATTCTCACAGGATTCATTATTGATTATA
GTGGATGGCGGGGAGCCATGTATGTTCCAGGCATTCTTTGTATTGGAATG
GGTTTAGTTTTAATTAATCGTTTACGAGACACGCCTCAGTCCTTAGGGCT
ACCTCCTATAGAGAAGTACAAGCGTGATCCCCATCACGCACATCACGAGG
GCAAATCAGCCTCAGAAGGAACTGAGGAAATCGAACGCGAGCTATCCACT
AGAGAAATTCTTTTTACCTATGTCCTTACAAATCAGTGGCTTTGGTTTTT
AGCTGCTGCCTCGTTCTTTATTTATATAGTACGAATGGCAGTCAACGATT
GGAGCGCTTTATTCCTTATTGAGACAAAACATTATGCGGCAGTGAAAGCC
AATTTTTGCGTATCTCTATTTGAGATTGGTGGTTTATTCGGCATGCTAGT
TGCTGGTTGGTTATCTGATAAGATTTCTAAGGGCAATCGTGGGCCTATGA
ACGTCCTCTTCTCTTTAGGTTTGCTGTTTGCTATTTTAGGCATGTGGTTT
TCACGTAGTCATAATCAGTGGTGGGTGGACGGAACCTTACTTTTCGTTAT
TGGTTTTTTCTTATACGGCCCTCAAATGATGATCGGTCTAGCAGCAGCAG
AACTCTCTCATAAAAAAGCTGCTGGTACTGCTAGCGGATTTACTGGATGG
TTCGCTTATTTTGGAGCTACCTTTGCAGGGTATCCTTTAGGAAAGGTTAC
TGATGTTTGGGGGTGGAAAGGGTTTTTCATTGCTCTCTTAGCCTGTGCAT
CCATAGCTTTATTGCTCTTTTTACCAACTTGGAACGCTACGGAGAAAAAC
ACTCGTAGTAAAGCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy