Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR523 IGR527 IGR524 IGR526 IGR525 CPn0664 mip, - CPn0661 aspS, - CPn0662 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 mip, - CPn0661 aspS, - CPn0662 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 mip, - CPn0661 aspS, - CPn0662 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666
* Calculated from Protein Sequence

Gene ID: CPn0664

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
744757

Gene Stop:
744554

Gene Length:
204

Molecular Weight*:
7569

pI*:
7.60

Net Charge*:
0.90

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKKLIALIGIFLVPIKGNTNKEHDAHATVLKAARAKYNLFFVQDVFPVHE
VIEPISPDCLVHYEGWV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATTGATTGCTTTGATAGGGATATTTCTTGTTCCAATAAAAGG
AAATACCAATAAGGAACACGACGCTCACGCGACTGTTTTAAAAGCGGCCA
GAGCAAAGTATAATTTGTTCTTTGTTCAGGATGTTTTCCCTGTACACGAA
GTTATCGAGCCTATTTCTCCCGATTGCCTGGTACATTATGAAGGGTGGGT
TTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy