Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR523 IGR527 IGR524 IGR526 IGR525 IGR522 CPn0664 CPn0658 mip, - CPn0661 aspS, - CPn0662 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 CPn0658 mip, - CPn0661 aspS, - CPn0662 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 CPn0658 mip, - CPn0661 aspS, - CPn0662 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666
* Calculated from Protein Sequence

Gene ID: CPn0663

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisS  

Definition:
histidyl-tRNA synthetase

Gene Start:
744190

Gene Stop:
742898

Gene Length:
1293

Molecular Weight*:
49507

pI*:
7.00

Net Charge*:
-0.07

EC:
6.1.1.21  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Histidyl-tRNA synthetase is a cytoplasmically located homodimer with similarity to class-II aminoacyl-tRNA synthetases.
Reaction: ATP + l-histidine + tRNA(his) = AMP + pyrophosphate + l-histidyl-tRNA(his).


Blast Summary:  PSI-Blast Search
CPn0663 is similar to CT543, a predicted histidyl-tRNA synthetase.
Residues 5-427 are 66% similar to CT543.

CPn0663 is orthologously related to CT543: residues 5-427 of CPn0663 are 66% similar to residues 5-427 of CT543, a predicted histidyl-tRNA synthetase from C. trachomatis.
CPn0663 is also simialr to UU285, MG035, TP0641, all predicted synthetases.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0124
COG name: Histidyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0124 is amtkYQVCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 165 (E-value = 3.3e-40) place CPn0663 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 334 to 424 (E-value = 3.2e-15) place CPn0663 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:


Gene Protein Sequence:
VTVTLPKGVFDIFPYLADAKQLWRHTSLWHSVEKAIHTVCMLYGFCEIRT
PIFEKSEVFLHVGEESDVVKKEVYSFLDRKGRSMTLRPEGTAAVVRSFLE
HGASHRSDNKFYYILPMFRYERQQAGRYRQHHQFGVEAIGVRHPLRDAEV
LALLWDFYSRVGLQHMQIQLNFLGGSETRFRYDKVLRAYLKESMGELSAL
SQQRFSTNVLRILDSKEPEDQEIIRQAPPILDYVSDEDLKYFNEILDALR
VLEIPYAINPRLVRGLDYYSDLVFEATTTFQEVSYALGGGGRYDGLISAF
GGASLPACGFGVGLERAIQTLLAQKRIEPQFPHKLRLIPMEPDADQFCLE
WSQHLRRLGIPTEVDWSHKKVKGALKAASTEQVSFVCLIGERELISQQLV
IKNMSLRKEFFGTKEEVEQRLLYEIQNTPL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACTGTAACTCTCCCCAAAGGGGTCTTTGATATATTTCCTTATCTTGC
AGATGCTAAACAATTGTGGCGTCACACTTCACTTTGGCATAGTGTTGAGA
AGGCAATTCATACCGTTTGCATGCTTTATGGATTTTGTGAAATTCGTACT
CCTATTTTTGAAAAATCAGAAGTGTTTTTACATGTAGGGGAAGAAAGTGA
TGTTGTTAAAAAAGAAGTCTATTCGTTTTTAGATAGAAAAGGTCGTTCCA
TGACTTTGCGTCCCGAAGGGACTGCCGCTGTTGTCCGTTCTTTTCTTGAA
CACGGGGCCTCTCATCGAAGTGATAATAAGTTCTATTATATTCTTCCCAT
GTTTCGCTACGAACGTCAGCAAGCGGGTAGATATCGTCAACACCATCAGT
TCGGTGTTGAGGCTATTGGTGTGCGTCACCCTCTAAGAGATGCAGAAGTT
CTCGCTTTGCTTTGGGATTTCTACTCTCGTGTCGGTTTGCAACATATGCA
AATTCAACTCAATTTCTTAGGAGGAAGTGAGACAAGATTTCGATACGATA
AGGTTCTACGCGCTTATTTGAAAGAGTCCATGGGAGAATTATCGGCATTA
AGCCAGCAGAGATTTTCAACGAATGTTTTGCGTATTTTGGATTCAAAGGA
GCCTGAAGATCAAGAAATTATCCGTCAAGCGCCCCCGATTCTAGACTATG
TTTCTGATGAAGATCTTAAGTATTTTAATGAAATTTTAGACGCTTTGAGA
GTTTTAGAAATCCCATATGCTATCAATCCTCGTTTAGTGCGTGGTTTGGA
TTATTATTCAGACTTAGTCTTTGAAGCGACTACCACATTCCAAGAGGTCT
CTTATGCCTTAGGGGGAGGCGGGCGCTATGACGGCTTGATTTCAGCTTTT
GGAGGAGCTTCTCTTCCTGCCTGTGGTTTCGGTGTTGGCCTTGAAAGAGC
GATTCAAACGTTATTAGCTCAAAAGCGTATTGAGCCACAGTTCCCTCATA
AACTGCGTTTGATTCCAATGGAACCAGATGCGGATCAGTTTTGTTTGGAA
TGGTCGCAACATTTGCGACGGTTAGGAATCCCTACGGAAGTCGATTGGTC
TCATAAAAAAGTAAAAGGAGCTCTAAAAGCAGCGAGTACAGAACAGGTTT
CTTTCGTTTGCTTAATCGGTGAGCGAGAGTTAATTTCTCAACAGTTAGTT
ATTAAAAATATGTCTCTGCGTAAAGAATTCTTTGGAACAAAAGAAGAAGT
AGAGCAAAGGTTGTTATATGAAATACAGAACACACCGTTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy