Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR523 IGR527 IGR521 IGR524 IGR520 IGR526 IGR525 IGR522 CPn0664 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 aspS, - CPn0662 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 aspS, - CPn0662 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666 CPn0664 dnaQ, - CPn0655 mip, - CPn0661 aspS, - CPn0662 CPn0657 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 CPn0658 CPn0657 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 dnaE, - CPn0666
* Calculated from Protein Sequence

Gene ID: CPn0662

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspS  

Definition:
aspartyl-tRNA synthetase

Gene Start:
742923

Gene Stop:
741169

Gene Length:
1755

Molecular Weight*:
66336

pI*:
5.50

Net Charge*:
-13.71

EC:
6.1.1.12  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Primary Evidence:
"A 28 KDA MAJOR IMMUNOGEN OF CHLAMYDIA-PSITTACI SHARES IDENTITY WITH MIP
PROTEINS OF LEGIONELLA SPP AND CHLAMYDIA-TRACHOMATIS : CLONING AND
CHARACTERIZATION OF THE CHLAMYDIA-PSITTACI MIP-LIKE GENE." 1996. ROCKEY
DD, CHESEBRO BB, HEINZEN RA, HACKSTADT T. MICROBIOLOGY-UK 142(pt.4):
945-953. *Notice gene order: aspS-mip-spoU-trxA.

Comment:
Aspartyl-tRNA synthetase is believed to be a homodimer and cytoplasmic.
Through similarity, it belongs to class-II aminoacyl-tRNA synthetases.

Reaction: ATP + l-aspartate + tRNA(asp) = AMP + pyrophosphate +
l-aspartyl-tRNA(asp).

Blast Summary:  PSI-Blast Search
CPn0662 is orthologously related to CT542: residues 1-582 of CPn0662 are 78% to residues 1-582 of CT542, a predicted aspartyl-tRNA synthetase from C. trachomatis.
CPn0662 is also similar to TP0985, UU286, MG036.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0173
COG name: Aspartyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0173 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
One potential paralog in C. pneumoniae, CPn0931: residues 92-300 of CPn0662 are 24% similar to residues 141-365 of CPn0931, a predicted lysyl tRNA synthetase.

Pfam Summary:  Pfam Search
Residues 20 to 105 (E-value = 5.1e-20) place CPn0662 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 123 to 558 (E-value = 2e-19) place CPn0662 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)
Residues 313 to 406 (E-value = 3.2e-45) place CPn0662 in the GAD family which is described as GAD domain (PF02938)

PDB Hit:


Gene Protein Sequence:
MKYRTHRCNELTSNHIGENVQLAGWVHRYRNHGGVVFIDLRDRFGITQIV
CREDEQPELHQRLDAVRSEWVLSVRGKVCPRLAGMENPNLATGHIEVEVA
SFEVLSKSQNLPFSIADDHINVNEELRLEYRYLDMRRGDIIEKLLCRHQV
MLACRNFMDAQGFTEIVTPVLGKSTPEGARDYLVPSRIYPGKFYALPQSP
QLFKQLLMVGGLDRYFQIATCFRDEDLRADRQPEFAQIDIEMSFGDTQDL
LPIIEQLVATLFATQGIEIPLPLAKMTYQEAKDSYGTDKPDLRFDLKLKD
CRDYAKRSSFSIFLDQLAHGGTIKGFCVPGGATMSRKQLDGYTEFVKRYG
AMGLVWIKNQEGKVASNIAKFMDEEVFHELFAYFDAKDQDILLLIAAPES
VANQSLDHLRRLIAKERELYSDNQYNFVWITDFPLFSLEDGKIVAEHHPF
TAPLEEDIPLLETDPLAVRSSSYDLVLNGYEIASGSQRIHNPDLQSQIFT
ILKISPESIQEKFGFFIKALSFGTPPHLGIALGLDRLVMVLTAAESIREV
IAFPKTQKASDLMMNAPSEIMSSQLKELSIKVAF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATACAGAACACACCGTTGTAATGAACTCACAAGTAATCATATAGG
TGAGAATGTTCAATTGGCAGGATGGGTGCACCGTTATCGTAATCATGGGG
GTGTTGTCTTCATAGATTTGCGAGATCGTTTTGGTATTACTCAAATTGTG
TGCCGTGAAGATGAGCAACCAGAACTGCACCAACGTTTGGATGCTGTGCG
TTCTGAATGGGTTCTTTCTGTACGAGGGAAAGTATGTCCACGTCTTGCAG
GAATGGAAAATCCTAACTTAGCAACAGGACATATTGAAGTTGAAGTTGCA
AGCTTTGAAGTGCTATCCAAGTCGCAAAATCTCCCTTTTTCCATTGCCGA
TGACCACATCAATGTGAATGAGGAGCTGCGTTTAGAGTATCGTTATCTAG
ATATGCGTCGCGGGGATATTATTGAGAAGTTGCTTTGTCGTCATCAGGTC
ATGCTTGCTTGCCGCAACTTTATGGATGCTCAAGGATTCACAGAAATCGT
GACCCCTGTATTAGGAAAATCCACTCCTGAAGGTGCTAGAGATTATCTTG
TTCCCTCTAGAATCTATCCTGGAAAATTTTATGCTCTACCGCAATCACCA
CAACTTTTTAAGCAGCTTTTAATGGTTGGAGGCTTGGATCGTTATTTCCA
AATCGCCACGTGCTTTAGAGACGAAGATTTGCGAGCAGATCGTCAACCTG
AATTTGCTCAAATAGATATTGAAATGAGCTTTGGGGATACCCAGGACCTA
CTTCCCATTATAGAACAATTGGTCGCAACACTGTTTGCTACGCAAGGTAT
AGAGATTCCTTTGCCTTTGGCTAAAATGACCTATCAAGAAGCTAAGGATT
CCTATGGTACAGATAAACCAGATTTAAGATTCGATCTTAAATTAAAAGAT
TGTCGAGACTATGCAAAACGTTCCTCATTCTCTATTTTCTTAGATCAGTT
GGCTCACGGAGGTACGATCAAAGGTTTTTGTGTTCCAGGTGGGGCTACTA
TGTCCCGCAAGCAACTCGATGGTTATACCGAGTTTGTAAAGCGTTATGGG
GCTATGGGGCTTGTCTGGATTAAAAATCAAGAGGGGAAAGTTGCTTCCAA
TATTGCTAAATTTATGGATGAAGAGGTTTTCCACGAACTCTTTGCTTATT
TTGATGCCAAAGATCAGGATATTTTGCTCTTGATAGCAGCTCCTGAATCA
GTAGCGAATCAGTCTCTCGATCATCTGCGTAGATTGATCGCAAAAGAGCG
CGAATTGTATAGCGACAATCAATATAACTTTGTTTGGATTACAGATTTCC
CTCTTTTCTCTTTAGAAGATGGAAAAATTGTGGCGGAACACCATCCGTTT
ACAGCACCTTTGGAGGAGGATATTCCTCTGTTAGAAACAGATCCTCTAGC
AGTGCGTTCGTCAAGCTATGACTTGGTTTTAAATGGATATGAAATTGCTT
CGGGATCTCAAAGAATTCATAACCCAGACTTGCAAAGTCAAATATTTACT
ATTTTAAAAATAAGTCCTGAGAGCATCCAAGAAAAATTTGGATTCTTTAT
CAAAGCTTTGAGTTTTGGAACCCCACCTCATCTAGGGATTGCCTTAGGGT
TAGATCGATTGGTTATGGTTTTAACAGCAGCAGAGAGCATTCGCGAGGTC
ATCGCGTTTCCTAAAACACAGAAAGCATCGGATCTTATGATGAATGCTCC
CTCAGAAATTATGTCTTCCCAATTAAAAGAGCTAAGTATTAAGGTAGCTT
TTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy