Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR523 IGR521 IGR524 IGR520 IGR526 IGR525 IGR522 CPn0664 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 CPn0664 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 CPn0664 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 CPn0658 CPn0657 CPn0656 trxA, - CPn0659 uhpC, - CPn0665
* Calculated from Protein Sequence

Gene ID: CPn0661

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mip  

Definition:
FKBP-type peptidyl-prolylcis-trans isomerase (MIP-like protein)

Gene Start:
741100

Gene Stop:
740324

Gene Length:
777

Molecular Weight*:
28316

pI*:
5.40

Net Charge*:
-4.35

EC:
5.2.1.8  

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table

Comment:
This mip-like peptidyl-prolyl cis-trans isomerase (PPIASE) is an outer
membrane protein that catalyzes cis-trans isomerization of proline imidic
peptide bonds in oligopeptides. See Lundemose et al., Mol. Microbiol. 5:109
(1991); Lundemose et al. Mol. Microbiol. 6:2539 (1992).

From Prosite PDOC00426:

FKBP is the major high-affinity binding protein, in vertebrates, for the
immunosuppressive drug FK506. It exhibits peptidyl-prolyl cis-trans isomerase
activity (EC 5.2.1.8) (PPIase or rotamase). PPIase is an enzyme that
accelerates protein folding by catalyzing the cis-trans isomerization of
proline imidic peptide bonds in oligopeptides.

Blast Summary:  PSI-Blast Search
CPn0661 is orthologously related to CT541: residues 1-248 of CPn0661 are 62% similar to residues 1-240 of CT541, a predicted peptidyl-prolyl cis-trans isomerase (MIP-like protein) from C. trachomatis.
CPn0661 is also similar to TP0862, a predicted peptidylprolyl isomerase (macrophage infectivity potentiator) from T. pallidum.


COGS Summary:  COGS Search
BeTs to 5 clades of COG0545
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 1
Functional Class:  O
The phylogenetic pattern of COG0545 is ----Y--cE--h-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 150 to 240 (E-value = 2.4e-31) place CPn0661 in the FKBP_C family which is described as FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
15
coil-coil  
97  
130

PDB Hit:


Gene Protein Sequence:
MNRRWNLVLATVALALSVASCDVRSKDKDKDQGSLVEYKDNKDTNDIELS
DNQKLSRTFGHLLARQLRKSEDMFFDIAEVAKGLQAELVCKSAPLTETEY
EEKMAEVQKLVFEKKSKENLSLAEKFLKENSKNAGVVEVQPSKLQYKIIK
EGAGKAISGKPSALLHYKGSFINGQVFSSSEGNNEPILLPLGQTIPGFAL
GMQGMKEGETRVLYIHPDLAYGTAGQLPPNSLLIFEINLIQASADEVAAV
PQEGNQGE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAGACGGTGGAATTTAGTTTTAGCAACAGTAGCTCTGGCACTCTC
CGTCGCTTCTTGTGACGTACGGTCTAAGGATAAAGACAAGGATCAGGGGT
CGTTAGTGGAATATAAAGATAACAAAGATACCAATGACATAGAATTATCC
GATAATCAAAAGTTATCCAGAACATTTGGTCATTTATTAGCACGCCAATT
ACGCAAGTCAGAAGATATGTTTTTTGATATTGCAGAAGTGGCTAAGGGGT
TGCAGGCGGAATTGGTTTGTAAAAGTGCTCCTTTAACAGAAACAGAGTAT
GAAGAAAAAATGGCTGAAGTACAGAAGTTGGTTTTTGAAAAAAAATCAAA
AGAAAATCTTTCATTGGCAGAAAAATTCTTAAAAGAAAATAGCAAGAACG
CTGGTGTTGTTGAAGTGCAACCAAGTAAATTGCAATACAAAATTATTAAA
GAAGGTGCAGGGAAAGCAATTTCAGGTAAACCTTCAGCTCTATTGCACTA
CAAGGGTTCCTTCATCAATGGCCAAGTATTTAGCAGTTCAGAAGGCAACA
ATGAGCCTATCTTGCTTCCTCTAGGCCAAACAATTCCTGGTTTTGCTTTA
GGTATGCAGGGCATGAAAGAAGGAGAAACTCGAGTTCTCTACATCCATCC
TGATCTTGCTTACGGAACCGCAGGACAACTTCCTCCAAACTCTTTATTAA
TTTTTGAAATTAACTTGATTCAGGCTTCAGCAGATGAAGTTGCTGCTGTA
CCCCAAGAAGGAAATCAAGGTGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy