Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR523 IGR521 IGR524 IGR520 IGR526 IGR525 IGR522 CPn0664 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 CPn0664 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 uhpC, - CPn0665 CPn0664 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 CPn0658 CPn0657 CPn0656 trxA, - CPn0659 uhpC, - CPn0665
* Calculated from Protein Sequence

Gene ID: CPn0660

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoU  

Definition:
ribosomal RNA methylase

Gene Start:
740327

Gene Stop:
739857

Gene Length:
471

Molecular Weight*:
17321

pI*:
8.20

Net Charge*:
2.28

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0660 is similar to MG346 in M. genitalium
and UU268 in U. urealyticum.

CPn0660 is orthologously related to CT540:
residues 1-145 are 74% similar to that of CT540.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0219
COG name: Predicted rRNA methylase (SpoU class)
Functional Class:  J
The phylogenetic pattern of COG0219 is -------cebrh--gp--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No no evidence of paralogs to C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 140 (E-value = 2.6e-37) place CPn0660 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

PDB Hit:


Gene Protein Sequence:
MRVVLHCPDIPQNTGNIGRTCVALGAELILVRPLGFSLADKFVKRAGMDY
WDKLQLTVVDSIEEALHDVPEDQIFCLSTKGSASYTEFSLPSSGTYVFGS
ESKGLPKEILKKYYKNCLRIPMQQDIRSLNLATSVGIVLYEVVRQKTVAL
QKNPTV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGTAGTTCTTCATTGTCCTGATATTCCACAGAATACTGGAAATAT
AGGTAGAACTTGTGTAGCCCTAGGCGCCGAACTCATTTTGGTTCGGCCCT
TGGGCTTTTCTTTAGCCGATAAATTTGTCAAACGTGCAGGGATGGACTAC
TGGGACAAACTCCAATTGACAGTAGTGGATTCTATAGAAGAAGCACTACA
TGATGTCCCTGAAGATCAGATTTTTTGTCTTTCTACCAAAGGTTCAGCAT
CTTATACTGAATTTTCCTTGCCATCTTCAGGCACCTACGTCTTTGGATCT
GAATCCAAAGGTCTTCCAAAAGAGATCTTAAAAAAATATTATAAAAATTG
CCTGCGCATTCCCATGCAACAAGACATCCGTTCTCTAAATTTAGCTACCA
GTGTAGGGATCGTTTTATATGAAGTGGTAAGGCAGAAAACCGTAGCATTG
CAAAAGAATCCTACGGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy