Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR523 IGR521 IGR518 IGR524 IGR520 IGR525 IGR522 CPn0664 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 CPn0664 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 CPn0664 CPn0658 CPn0657 CPn0656 trxA, - CPn0659
* Calculated from Protein Sequence

Gene ID: CPn0659

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trxA  

Definition:
thioredoxin

Gene Start:
739533

Gene Stop:
739841

Gene Length:
309

Molecular Weight*:
11275

pI*:
4.70

Net Charge*:
-4.62

EC:
 

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table

Comment:
Thioredoxin (TRX) is involved in several redox reactions.
See Rockey et al. Microbiol. 142:945 (1996). See CPn0314, a
trxB sequence.

Blast Summary:  PSI-Blast Search
CPn0659 is orthologously related to CT539, a predicted thioredoxin: residues
1-101 are 72% similar to CT539. CPn0659 is also similar to TP0919,
MG124, and UU589, predicted thioredoxins.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0526
COG name: Thiol-disulfide isomerase and thioredoxins
Functional Class:  O,C
The phylogenetic pattern of COG0526 is AMTkYQVCEBRHUJgpoLINX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 102 (E-value = 8.9e-34) place CPn0659 in the Thioredoxin family which is described as Thioredoxin (PF00085)

PDB Hit:


Gene Protein Sequence:
MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAELPHVTI
GKINIDENSKPAETYEVSSIPTLILFKDGNEVARVVGLKDKEFLTNLINK
HA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAAAGATCATATCAAGTGAAAATTTTGACTCTTTTATTGCATCGGG
GCTCGTTCTCGTTGATTTCTTTGCAGAATGGTGTGGCCCCTGTCGGATGC
TCACTCCTATCTTAGAAAATCTTGCTGCGGAACTTCCTCATGTCACTATT
GGAAAAATCAATATAGATGAGAACAGCAAGCCTGCAGAAACGTACGAAGT
CAGCTCTATTCCTACGCTTATTCTTTTTAAGGATGGGAACGAGGTGGCTC
GGGTCGTAGGTCTTAAGGATAAAGAATTCCTAACCAATCTTATCAATAAG
CACGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy