Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR517 IGR523 IGR521 IGR518 IGR524 IGR520 IGR522 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 CPn0658 fabZ, - CPn0651 CPn0657 CPn0656 trxA, - CPn0659
* Calculated from Protein Sequence

Gene ID: CPn0658

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
739168

Gene Stop:
738452

Gene Length:
717

Molecular Weight*:
27355

pI*:
4.90

Net Charge*:
-6.60

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0658 is orthologously related to CT538: residues 1-238 of CPn0658 are 83% similar to residues 1-238 of CT538, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MDISGAVKQKLLQFLGKQKKPELLATYLFYLEQALSLRPVVFVRDKIIFK
TPEDAVRILEQDKKIWRETEIQISSEKPQVNENTKRIYICPFTGKVFADN
VYANPQDAIYDWLSSCPQNMEKQGGVRIKRFLVSEDPDVIKEYAVPPKEP
IIKTVFASAITGKLFHSLPPLLEDFISSYLRPMTLEEVQNQTKFQLESSF
LSLLQDALVEDKIAAFIESLADDTAFHVYISQWVDTEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATATTTCTGGAGCAGTCAAACAGAAACTTTTGCAGTTTTTGGGAAA
ACAAAAAAAACCAGAATTGTTGGCAACGTATCTTTTCTATCTGGAACAGG
CTCTAAGCCTTCGTCCTGTGGTGTTTGTTCGCGACAAGATAATTTTCAAA
ACTCCAGAAGATGCGGTCCGTATTCTCGAACAGGATAAAAAGATTTGGAG
AGAAACAGAAATCCAAATTTCTTCTGAAAAGCCACAGGTAAACGAAAATA
CGAAGCGTATCTATATTTGCCCATTTACCGGTAAGGTCTTTGCTGACAAC
GTCTATGCAAACCCTCAAGACGCAATTTATGACTGGCTGTCTTCTTGCCC
TCAAAATATGGAAAAACAGGGTGGGGTGCGAATCAAGCGTTTCCTCGTAT
CAGAAGATCCTGATGTGATAAAAGAATACGCAGTCCCACCAAAAGAACCT
ATTATAAAAACAGTGTTTGCTTCGGCAATTACAGGTAAATTGTTCCATAG
TTTACCCCCTCTTTTAGAGGATTTTATCTCTAGCTACTTGCGTCCTATGA
CCCTGGAAGAAGTGCAAAATCAAACTAAGTTTCAATTGGAAAGTTCCTTC
CTTTCTCTATTGCAAGATGCGCTGGTAGAAGATAAGATCGCAGCATTTAT
AGAAAGTTTAGCAGACGATACAGCCTTTCATGTGTACATTAGCCAATGGG
TAGATACAGAAGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy