Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR517 IGR516 IGR523 IGR521 IGR518 IGR524 IGR520 IGR522 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxA, - CPn0650 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxA, - CPn0650 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 lpxA, - CPn0650 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 hisS, - CPn0663 spoU, - CPn0660 hisS, - CPn0663 CPn0658 fabZ, - CPn0651 CPn0657 CPn0656 trxA, - CPn0659
* Calculated from Protein Sequence

Gene ID: CPn0657

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic) (possible ATPase or kinase)

Gene Start:
738473

Gene Stop:
738048

Gene Length:
426

Molecular Weight*:
16177

pI*:
4.80

Net Charge*:
-6.42

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Could be an ATPase or kinase (yjeE).

Blast Summary:  PSI-Blast Search
CPn0657 is orthologously related to CT537: residues 1-138 of CPn0657 are 51% similar to residues 1-142 of CT537, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0802
COG name: Predicted nucleotide-binding protein, YjeE family
Functional Class:  R
The phylogenetic pattern of COG0802 is -----qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 14 to 136 (E-value = 1.3e-62) place CPn0657 in the UPF0079 family which is described as Uncharacterised P-loop hydrolase UPF0079 (PF02367)

PDB Hit:


Gene Protein Sequence:
MGRYRRVSHSSQETLLLGTELGQVLVPGAVLLLFGDYGAGKTEFVRGIVS
GYLGDTIAEEVASPSFSILHVYGNEPKRLCHYDLYRIDQKNQEYIFQDAE
EDDVLCIEWADRLPKPRFCDTINIYITMQTNMEREIIIEKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAGATACAGAAGAGTAAGCCATTCTTCTCAAGAAACCCTATTACT
AGGAACTGAGTTAGGACAAGTCCTTGTTCCAGGAGCTGTATTGCTCTTAT
TTGGTGATTATGGGGCTGGTAAGACAGAATTTGTACGTGGCATAGTCTCT
GGATATCTCGGAGATACTATCGCGGAAGAAGTTGCTAGTCCCTCGTTCTC
TATATTACATGTTTATGGTAATGAACCTAAGCGGTTGTGCCACTATGATC
TTTACCGGATTGATCAGAAAAATCAGGAATACATTTTTCAAGATGCAGAA
GAAGACGATGTCCTTTGTATTGAATGGGCGGATCGCTTGCCTAAGCCACG
ATTTTGTGATACAATAAATATCTACATTACCATGCAAACAAACATGGAAA
GAGAAATTATTATAGAGAAGCGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy