Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR517 IGR516 IGR523 IGR521 IGR518 IGR524 IGR520 IGR522 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 lpxA, - CPn0650 spoU, - CPn0660 lpxA, - CPn0650 CPn0658 fmt, - CPn0649 CPn0657 CPn0656 trxA, - CPn0659
* Calculated from Protein Sequence

Gene ID: CPn0655

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaQ  

Definition:
DNA polymerase III alpha chain

Gene Start:
737847

Gene Stop:
737098

Gene Length:
750

Molecular Weight*:
28704

pI*:
7.90

Net Charge*:
2.98

EC:
 2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
CP0655 is similar to TP0643 in T. pallidum, UU377 in U. urealyticum and MG031 in M. genitalium.

CPn0655 is orthologously related to CT536 and
they share 73% similarity. CPn0655 is also similar to CT261, a predicted DNA polymerase III alpha/epsilon chain.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class:  L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0655 is paralogously related to CPn0410, a
predicted DNA polymerase III epsilon chain:
residues 13-212 are 32% similar to residues 13-211.



Pfam Summary:  Pfam Search
Residues 9 to 166 (E-value = 2.9e-52) place CPn0655 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:


Gene Protein Sequence:
MSLLKDTVFTCLDCEMTGLDVKKDRIIEIAAVRFTFDSVISSIEFLINPE
RVVSAESQRVHHISNAMLRDQPKIAEVFPQIKAFFKEGDYIVGHSVGFDL
QVLAQEMERIGETFLSKYTIIDTLRLAKEYGDSPNNSLESLAVHFNVPYD
GNHRAMKDVEININIFKHLCKRFRTLEQLKQVLAKPIKMKYMPLGKHKGR
CFSEIPLAYLQWASKMDFDSDLLFSIRHEIKHRQKGTGFSQVNNPFMEL$


Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTATTAAAAGATACGGTTTTTACTTGCCTAGATTGTGAAATGAC
AGGTCTAGATGTAAAAAAAGATCGTATTATTGAAATTGCCGCTGTTCGCT
TTACTTTCGATAGTGTAATTAGTTCGATAGAATTTTTAATCAATCCAGAA
CGCGTTGTATCTGCGGAGTCCCAGAGAGTCCACCATATCTCCAACGCTAT
GTTGAGAGATCAGCCGAAAATCGCCGAAGTTTTTCCTCAAATCAAAGCAT
TTTTTAAAGAAGGCGACTATATCGTAGGACATAGCGTCGGTTTTGATTTG
CAGGTTCTCGCTCAAGAGATGGAAAGAATCGGAGAGACCTTCCTCTCAAA
GTATACCATTATTGATACCCTCCGATTAGCAAAAGAATATGGAGATAGTC
CTAATAATTCTCTAGAATCCTTAGCCGTACACTTTAATGTTCCCTATGAT
GGGAATCATCGTGCCATGAAGGATGTAGAAATTAATATCAATATTTTTAA
ACATCTTTGTAAACGTTTCCGAACGTTAGAACAACTGAAACAGGTGTTAG
CAAAACCTATTAAAATGAAATATATGCCCCTAGGGAAACACAAGGGACGA
TGTTTTTCAGAAATTCCTCTTGCCTATCTTCAATGGGCATCAAAAATGGA
TTTCGATTCAGACCTTCTTTTTTCTATCCGTCATGAAATCAAGCATAGAC
AAAAGGGGACCGGATTTTCACAAGTTAACAATCCCTTTATGGAATTGTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy