Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR517 IGR516 IGR523 IGR521 IGR518 IGR524 IGR520 IGR522 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 cutE,lnt, - CPn0653 aspS, - CPn0662 CPn0657 spoU, - CPn0660 lpxA, - CPn0650 spoU, - CPn0660 lpxA, - CPn0650 CPn0658 CPn0657 CPn0656 trxA, - CPn0659
* Calculated from Protein Sequence

Gene ID: CPn0654

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yciA  vldD  

Definition:
acyl CoA thioester hydrolase

Gene Start:
736967

Gene Stop:
736500

Gene Length:
468

Molecular Weight*:
17868

pI*:
9.30

Net Charge*:
4.82

EC:
3.1.2.2  

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0654 is orthologous to CT535, a predicted acyl CoA thioester hydrolase:
residues 3-174 are 78% similar to CT535. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1607
COG name: Acyl-CoA hydrolase
Functional Class:  I
The phylogenetic pattern of COG1607 is --------eb-huj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 27 to 105 (E-value = 2.1e-13) place CPn0654 in the 4HBT family which is described as Thioesterase superfamily (PF03061)

PDB Hit:


Gene Protein Sequence:
MLKKKPVSFSCIDGHIYKIFPNDLNANNTVFGGLLMSLLDRLALVVAERH
TESVCVTAFVDALRFYAPAYMGENLICKAAVNRTWRTSLEVGVKVWAENI
YKQERRHITSAYFTFVAVNEDNQPIPVHQIVPETPEEKRRYNEADRRRQA
RLELK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAGAAAAAACCCGTCTCGTTTAGCTGTATTGACGGACATATTTA
TAAAATTTTCCCTAATGATCTTAATGCTAATAATACTGTCTTCGGGGGAT
TATTAATGAGTTTGCTCGATCGTTTAGCCTTAGTGGTCGCAGAACGACAC
ACAGAATCCGTCTGTGTTACTGCTTTTGTTGATGCCCTCCGCTTCTATGC
TCCTGCATATATGGGGGAAAATCTGATTTGTAAAGCTGCAGTAAACAGAA
CATGGCGTACTTCCCTAGAAGTCGGGGTTAAAGTGTGGGCAGAAAATATT
TATAAGCAGGAACGACGTCATATTACCTCCGCATACTTTACATTTGTTGC
TGTCAACGAAGACAACCAGCCCATTCCTGTCCATCAGATTGTTCCAGAAA
CTCCAGAAGAAAAACGTCGGTATAATGAAGCAGATCGACGACGTCAAGCA
AGGCTTGAACTGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy