Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR517 IGR516 IGR523 IGR521 IGR518 IGR515 IGR520 IGR522 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 CPn0658 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 trxA, - CPn0659 fabZ, - CPn0651 yciA,vldD, - CPn0654 dnaQ, - CPn0655 mip, - CPn0661 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0657 spoU, - CPn0660 lpxA, - CPn0650 spoU, - CPn0660 lpxA, - CPn0650 CPn0658 CPn0657 CPn0656 trxA, - CPn0659
* Calculated from Protein Sequence

Gene ID: CPn0653

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cutE  lnt  

Definition:
apolipoprotein N-acyltransferase

Gene Start:
736490

Gene Stop:
734865

Gene Length:
1626

Molecular Weight*:
61218

pI*:
10.00

Net Charge*:
24.89

EC:
2.3.1.-  

Functional Class:
central intermediary metabolism; amino sugars  
fatty acid and phospholipid metabolism  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis
Metabolism of Complex Lipids; Glycerolipid metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:
This enzyme appears to be responsible for transfer of fatty acyl groups on
lipoproteins. In HAEIN it is an integral membrane protein.

Blast Summary:  PSI-Blast Search
CPn0653 is orthologously related to CT534: residues 8-539 of CPn0653 are 51% similar to residues 9-535 of CT534, a predicted apolipoprotein N-acyltransferase from C. trachomatis.
CPn0653 is also similar to TP0417, a predicted apolipoprotein N-acyltransferase from T. pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0815
COG name: Apolipoprotein N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG0815 is -----qvce-Rhuj--oLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 221 to 429 (E-value = 1.2e-12) place CPn0653 in the CN_hydrolase family which is described as Carbon-nitrogen hydrolase (PF00795)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
17
transmembrane  
54  
71
transmembrane  
83  
105
transmembrane  
119  
136
transmembrane  
164  
181
transmembrane  
187  
204
non-globular  
220  
269
transmembrane  
512  
529

PDB Hit:


Gene Protein Sequence:
VLRIFCFVISWCLIAFAQPDLSGFVSILGAACGYGFFWYSLEPLKKPSLP
LRTLFVSCFFWIFTIEGIHFSWMLSDQYIGKLIYLVWLTLITILSVLFSG
FSCLLVAIVRQKRTAFLWSLPGVWVAIEMLRFYGIFSGMSFDYLGWPMTA
SAYGRQFGGFLGWAGQSFAVIAVNMSFYCLLLKKPHAKMLWVLTLLLPYT
FGAIHYEYLKHAFQQDKRALRVAVVQPAHPPIRPKLKSPIVVWEQLLQLV
SPIQQPIDLLIFPEVVVPFGKHRQVYPYESCAHLLSSFAPLPEGKAFLSN
SDCATALSQHFQCPVIIGLERWVKKENVLYWYNSAEVISHKGISVGYDKR
ILVPGGEYIPGGKFGSLICRQLFPKYALGCKRLPGRRSGVVQVRGLPRIG
ITICYEETFGYRLQSYKRQGAELLVNLTNDGWYPESRLPKVHFLHGMLRN
QEFGMPCVRACQTGVTAAVDSLGRILKILPYDTRETKAPSGVLETSLPLF
NYKTLYGYCGDYPMILIAFCAVSYLGGGFLGYRLLAKKEIR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTACGAATCTTTTGCTTTGTTATTTCTTGGTGCCTTATAGCTTTTGC
TCAACCAGATTTAAGTGGATTCGTTTCCATATTAGGAGCCGCCTGTGGTT
ATGGATTCTTTTGGTATAGTCTAGAACCCTTAAAAAAACCCTCATTACCT
CTAAGGACTCTTTTTGTATCCTGTTTTTTCTGGATCTTCACAATAGAGGG
GATTCATTTTTCTTGGATGCTCTCGGATCAATATATAGGCAAACTCATCT
ATTTGGTATGGCTTACATTAATCACGATTTTGTCCGTTCTATTTTCAGGA
TTTTCTTGCCTTCTAGTTGCAATCGTACGTCAGAAACGCACAGCTTTTTT
ATGGAGCCTTCCTGGCGTATGGGTCGCTATCGAGATGCTTCGATTTTATG
GGATCTTTTCTGGGATGTCCTTCGATTATCTTGGTTGGCCTATGACAGCC
TCTGCTTATGGACGGCAGTTTGGCGGATTTTTGGGGTGGGCAGGTCAGAG
CTTCGCTGTCATAGCTGTAAATATGAGCTTTTATTGTCTACTACTGAAAA
AACCTCATGCTAAAATGTTATGGGTGCTCACTCTTCTTTTGCCCTATACT
TTTGGAGCAATTCATTATGAGTATCTTAAACACGCGTTTCAACAAGATAA
GAGAGCGCTGCGTGTCGCTGTTGTTCAACCCGCGCATCCCCCCATACGAC
CGAAACTTAAGTCCCCAATAGTCGTCTGGGAACAACTCCTCCAACTCGTA
TCCCCAATACAACAACCCATAGATTTGCTGATTTTCCCAGAAGTAGTCGT
GCCTTTTGGTAAGCATAGGCAAGTCTATCCCTATGAATCCTGCGCACATT
TATTGTCTTCTTTTGCTCCACTTCCCGAAGGTAAGGCATTTCTATCGAAT
AGTGATTGTGCCACAGCTCTGTCACAACACTTTCAGTGTCCAGTAATTAT
TGGCTTAGAACGGTGGGTGAAAAAAGAGAACGTTTTGTATTGGTATAACT
CTGCTGAGGTAATATCACACAAAGGAATTTCCGTAGGATACGATAAGCGT
ATCCTTGTGCCTGGTGGCGAATATATACCAGGAGGGAAATTCGGATCCCT
AATTTGTAGACAACTATTTCCTAAATATGCTCTAGGATGCAAGAGACTTC
CAGGTAGACGTTCTGGAGTTGTGCAGGTCCGAGGTTTACCTCGTATCGGG
ATCACCATTTGCTACGAAGAAACTTTCGGCTATCGGTTGCAATCCTACAA
GAGACAAGGAGCCGAACTCCTTGTTAACTTAACAAATGACGGATGGTATC
CTGAATCACGACTCCCTAAAGTCCATTTCCTCCATGGGATGTTGAGAAAT
CAAGAGTTTGGGATGCCTTGCGTGCGAGCTTGCCAAACTGGTGTTACAGC
AGCTGTGGATTCTCTAGGTCGAATACTCAAAATTCTTCCTTATGATACTA
GAGAAACTAAAGCCCCCTCAGGGGTATTGGAAACCTCTTTGCCTCTATTT
AATTATAAAACGCTTTATGGGTATTGTGGAGATTACCCTATGATTTTGAT
AGCTTTCTGTGCAGTCAGTTATCTAGGAGGAGGATTCTTAGGATATCGCT
TGCTTGCTAAAAAAGAAATTCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy