Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_4 IGR519 IGR517 IGR516 IGR521 IGR518 IGR513 IGR515 IGR520 IGR514 IGR522 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 CPn0658 dnaQ, - CPn0655 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 CPn0658 dnaQ, - CPn0655 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0657 lpxA, - CPn0650 lpxA, - CPn0650 CPn0658 CPn0657 CPn0656
* Calculated from Protein Sequence

Gene ID: CPn0652

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxC  

Definition:
UDP-3-O-acyl-GlcNAc deacetylase

Gene Start:
734835

Gene Stop:
733987

Gene Length:
849

Molecular Weight*:
0

pI*:
6.40

Net Charge*:
-3.06

EC:
3.5.1.-  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  
fatty acid and phospholipid metabolism  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:
This enzyme is involved in lipid A biosynthesis: the acetyl group is removed
through hydrolysis from UDP-3-O-(3-hydroxytetradecanoyl)-N-acetylglucosamine.

Blast Summary:  PSI-Blast Search
Several significant hits with gapped BLAST to various deacetylases; i.e., residues 6-269 are 35% similar to UDP-3-O-acyl-GlcNAc deacetylase in P. aeruginosa (accession U67855); residues 6-280 are 36% similar to UDP-3-O-[3-HYDROXYMYRISTOYL] N-ACETYLGLUCOSAMINE DEACETYLASE from H. influenzae (accession P45070); residues 6-280 are 35% similar to UDP-3-O-[3-HYDROXYMYRISTOYL] N-ACETYLGLUCOSAMINE DEACETYLASE LpxC in Rickettsia prowazekii (accession CAA14716).

CPn0652 is orthologously related to CT533: residues 1-281 of CPn0652 are 71% similar to residues 1-279 of CT533, a predicted UDP-3-O-acyl-GlcNAc deacetylase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0774
COG name: UDP-3-0-acyl-N-acetylglucosamine deacetylase
Functional Class:  M
The phylogenetic pattern of COG0774 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 281 (E-value = 9.2e-180) place CPn0652 in the LpxC family which is described as UDP-3-O-acyl N-acetylglycosamine deacetylase (PF03331)

PDB Hit:


Gene Protein Sequence:
MLERTQRTLKREVRYSGVGIHLGKSSTLHLQPAQTNTGIVFQRQSASGNY
ENVPALLDHVYTTGRSTTLSRGSAVIATVEHLMAALRSNNIDNLIIQCSG
EEIPIGDGSSNVFVELIDQAGICEQEDKVSIARLTRPVYYQHQDIFLAAF
PSDELKISYTLHYPQSSTIGTQYKSLVINEESFRQEIAPCRTFALYNELC
FLMEKGLIGGGCLDNAVVFKDDGIISRGQLRFADEPVRHKILDLIGDLSL
VGRPFVAHVLAVGSGHSSNIAFGKKILEALEL$

Gene Nucleotide Sequence:  Sequence Viewer
atgttagaacgaactcaaagaacgttaaagcgagaggttcgctattctgg
agtgggaattcacttagggaagtcctcaactctccatttgcaacctgcac
aaacaaatacaggtattgtttttcaaagacagtctgcctcaggtaactac
gaaaatgtccctgctttactagatcatgtctacactacaggaagaagtac
aacattatctaggggtagtgctgtaatcgccactgtcgaacatcttatgg
cagcattgcgatctaacaatatagataatctaattatccaatgtagtgga
gaggaaatccccataggggatggaagctcaaatgtctttgttgagttaat
cgatcaagcaggtatttgtgaacaagaagataaggtttccattgcgagac
taacacgtcctgtatattatcaacatcaggacatttttttagcagccttt
ccctctgatgagctgaagatttcctatacgttgcattatcctcaaagttc
aacaatagggactcaatacaaatctttggtgattaatgaagagtcttttc
gccaggaaattgctccttgtagaacatttgctctatacaatgagctatgt
ttcttaatggaaaaggggctaattggagggggatgtttggataatgctgt
agtttttaaggacgatggtattattagtagaggacaattaagatttgccg
atgaaccagtacgacataaaatactggatctgattggagatctttcctta
gttggcaggccttttgttgcgcatgtattagctgtcggctccggccactc
ctccaatattgcttttggtaaaaaaattttggaagcattagaactataa


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy