Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR519 IGR517 IGR516 IGR512 IGR521 IGR518 IGR513 IGR515 IGR520 IGR514 rl23, - CPn0645 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 CPn0658 dnaQ, - CPn0655 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 rl23, - CPn0645 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 CPn0658 dnaQ, - CPn0655 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0657 lpxA, - CPn0650 lpxA, - CPn0650 CPn0658 rl23, - CPn0645 CPn0657 CPn0656
* Calculated from Protein Sequence

Gene ID: CPn0651

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabZ  

Definition:
(3R)-hydroxymyristoyl-acp-dehydratase

Gene Start:
733975

Gene Stop:
733514

Gene Length:
462

Molecular Weight*:
16909

pI*:
9.10

Net Charge*:
1.47

EC:
4.2.1.-  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Alkaloid biosynthesis I
Bile acid biosynthesis
Butanoate metabolism
Cyanoamino acid metabolism
Fructose and mannose metabolism
Phenylalanine metabolism
Tryptophan metabolism
Tyrosine metabolism

Comment:
In E.coli, the (3R)-hydroxymyristoyl-ACP dehydratase is involved in lipid A
biosynthesis. See Mohan et al., J.Biol.Chem. 269:32896 (1994).

Blast Summary:  PSI-Blast Search
CPn0651 is orthologous to CT532, a predicted (3R)-hydroxymyristoyl-acp-dehydratase:
residues 1-153 are 75% similar to CT532. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0764
COG name: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases
Functional Class:  I
The phylogenetic pattern of COG0764 is -----qvcEB-Huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 52 to 141 (E-value = 5.6e-15) place CPn0651 in the 4HBT family which is described as Thioesterase superfamily (PF03061)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
59  
76

PDB Hit:


Gene Protein Sequence:
MNQPSVIKLRELLDLLPHRYPFLLVDKVLSYDIEARSITAQKNVTINEPF
FMGHFPNAPIMPGVLILEALAQAAGVLIGLVLENDRNKRIALFLGIQKAK
FRQAVRPGDVLTLQADFSLISSKGGKAWAQARVDSQLVTEAELSFALVDK
ESI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAACCCTCTGTCATCAAATTACGCGAATTATTAGATTTACTCCC
CCACAGATATCCTTTTTTATTAGTGGATAAAGTTTTATCTTATGACATCG
AGGCTCGCAGTATCACGGCACAAAAAAATGTCACAATAAATGAGCCTTTT
TTTATGGGGCATTTTCCTAACGCGCCTATTATGCCTGGAGTCTTGATATT
AGAAGCTTTGGCCCAAGCTGCTGGTGTATTGATAGGCTTAGTTCTAGAAA
ATGATAGGAATAAGCGTATCGCATTATTTTTAGGGATACAGAAAGCTAAG
TTTCGTCAAGCTGTTCGCCCTGGAGATGTACTTACCCTGCAAGCAGATTT
TTCTTTAATATCATCGAAAGGAGGTAAAGCTTGGGCACAGGCGCGTGTAG
ATTCACAGCTAGTCACTGAAGCAGAGCTGAGCTTTGCTCTGGTAGATAAG
GAATCCATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy