Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR519 IGR517 IGR516 IGR512 IGR511 IGR521 IGR518 IGR513 IGR515 IGR520 IGR514 rl23, - CPn0645 CPn0657 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 rl23, - CPn0645 CPn0657 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 CPn0656 rl23, - CPn0645 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 lpxA, - CPn0650 lpxA, - CPn0650 CPn0657 CPn0656
* Calculated from Protein Sequence

Gene ID: CPn0650

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxA  

Definition:
UDP-N-acetylglucosamine acyltransferase

Gene Start:
733501

Gene Stop:
732662

Gene Length:
840

Molecular Weight*:
30331

pI*:
6.40

Net Charge*:
-2.59

EC:
2.3.1.129  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Aminosugars metabolism

Comment:
In E.coli, LPXA is involved in the first step of lipid A biosynthesis;
lipid A is an endotoxin that anchors LPS to the outer membrane.
An Xray crystallographic structure is known for this molecule.

Blast Summary:  PSI-Blast Search
CPn0650 is orthologous to CT531, a predicted UDP-N-acetylglucosamine acyltransferase:
residues 1-279 are 72% similar to CT531. CPn0650 is CT243. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1043
COG name: Acyl-[acyl carrier protein]--UDP-N-acetylglucosamine O-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1043 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0650 is paralogous to CPn0302, a predicted UDP Glucosamine N-Acyltransferase: residues
4-186 are 27% similar to residues 108-314 of CPn0302.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MASIHPTAIIEPGAKIGKDVVIEPYVVIKATVTLCDNVVVKSYAYIDGNT
TIGKGTTIWPSAMIGNKPQDLKYQGEKTYVTIGENCEIREFAIITSSTFE
GTTVSIGNNCLIMPWAHVAHNCTIGNNVVLSNHAQLAGHVQVGDYAILGG
MVGVHQFVRIGAHAMVGALSGIRRDVPPYTIGSGNPYQLAGINKVGLQRR
QVPFATRLALIKAFKKIYRADGCFFESLEETLEEYGDIPEVKNFIEFCQS
PSKRGIERSIDKQALEEESADKEGVLIES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGAGCATTCACCCAACTGCAATTATCGAGCCAGGAGCTAAAATTGG
AAAGGATGTTGTTATTGAACCGTACGTTGTTATAAAAGCTACGGTAACCC
TTTGTGACAACGTTGTTGTTAAGTCCTACGCATATATCGATGGCAATACA
ACCATAGGCAAGGGGACAACAATATGGCCCTCTGCAATGATCGGTAATAA
ACCCCAAGATTTAAAGTATCAAGGGGAAAAAACCTATGTGACTATTGGTG
AAAATTGCGAAATTCGAGAGTTCGCTATCATCACGTCTTCAACATTCGAA
GGTACAACAGTCTCTATCGGGAATAATTGTTTGATTATGCCCTGGGCTCA
TGTTGCCCATAACTGTACTATTGGAAATAATGTCGTTCTAAGTAACCATG
CACAACTTGCAGGACATGTTCAAGTCGGTGATTACGCTATTCTTGGTGGG
ATGGTTGGAGTGCACCAGTTTGTTCGCATCGGAGCGCATGCTATGGTAGG
AGCCCTCAGTGGGATTCGTCGTGATGTTCCTCCCTATACCATTGGAAGTG
GAAACCCTTACCAACTCGCTGGTATTAATAAAGTAGGACTACAACGTAGG
CAGGTTCCTTTTGCTACGCGATTAGCCCTCATTAAGGCTTTTAAAAAGAT
TTATCGTGCTGACGGATGTTTTTTTGAATCTCTAGAAGAAACTCTAGAAG
AATATGGAGACATTCCAGAAGTAAAAAACTTCATTGAGTTTTGTCAAAGC
CCAAGTAAGCGCGGCATCGAACGAAGCATAGATAAGCAAGCCCTTGAAGA
AGAAAGCGCAGACAAAGAAGGAGTTTTGATTGAATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy