Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR510 IGR519 IGR517 IGR516 IGR512 IGR509 IGR511 IGR518 IGR513 IGR515 IGR520 IGR514 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 fabZ, - CPn0651 yciA,vldD, - CPn0654 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rl22, - CPn0642 rl23, - CPn0645 fabZ, - CPn0651 rl4, - CPn0646 rl3, - CPn0647 dnaQ, - CPn0655 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 lpxA, - CPn0650 lpxA, - CPn0650 rs19, - CPn0643 yciA,vldD, - CPn0654
* Calculated from Protein Sequence

Gene ID: CPn0649

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fmt  

Definition:
methionyl tRNA formyltransferase

Gene Start:
732672

Gene Stop:
731707

Gene Length:
966

Molecular Weight*:
34509

pI*:
8.80

Net Charge*:
5.26

EC:
2.1.2.9  

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table
Amino Acid Metabolism; Methionine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Methionyl-tRNA formyltransferase modifies the free amino group of the aminoacyl moiety of methionyl-tRNA(FmeT). The formyl
group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by: (I) promoting its recognition by If2 and (II) impairing its binding to EftU/GTP.
Monomeric.

This enzyme catalyzes the addition of the formyl moiety to met-tRNA:
10-formyltetrahydrofolate + L-met-tRNA -> N-formylmethionyly-tRNA + tetrahydrofolate. In
E.coli, the enzyme is a monomer (a 3D structure is available).

From Prosite PDOC00319:

Escherichia coli methionyl-tRNA formyltransferase (EC 2.1.2.9) (gene fmt) is the enzyme
responsible for modifying the free amino group of the aminoacyl moiety of
methionyl-tRMA(fMet). The central part of fmt seems to be evolutionary related to GART's
active site region.

Blast Summary:  PSI-Blast Search
CPn0649 is orthologously related to CT530: residues 1-307 of CPn0649 are 60% similar to residues 1-307 of CT530, a predicted methionyl-tRNA formyltransferase from C. trachomatis.
CPn0649 is also similar to UU463, TP0756, MG365.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0223
COG name: Methionyl-tRNA formyltransferase
Functional Class: J
The phylogenetic pattern of COG0223 is ----yQvcEbRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 182 (E-value = 8.8e-39) place CPn0649 in the Formyl_trans_N family which is described as Formyl transferase (PF00551)
Residues 207 to 309 (E-value = 1.5e-40) place CPn0649 in the Formyl_trans_C family which is described as Formyl transferase, C-terminal domain (PF02911)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
158  
214

PDB Hit:


Gene Protein Sequence:
LNLKVVYFGTPTFAATVLQDLLHHKIQITAVVTRVDKPQKRSAQLIPSPV
KTIALTHGLPLLQPSKASDPQFIEELRAFNADVFIVVAYGAILRQIVLDI
PRYGCYNLHAGLLPAYRGAAPIQRCIMEGATESGNTVIRMDAGMDTGDMA
NITRVPIGPDMTSGELADALASQGAEVLIKTLQQIESGQLQLVSQDAALA
TIAPKLSKEEGQVPWDKPAKEAYAHIRGVTPAPGAWTLFSFSEKAPKRLM
IRKASLLAEAGRYGAPGTVVVTDRQELAIACSEGAICLHEVQVEGKGSTN
SKSFLNGYPAKKLKIVFTLNN$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATCTTAAGGTTGTCTATTTCGGCACACCCACATTTGCAGCCACCGT
TTTGCAAGATTTGTTGCATCACAAAATCCAAATTACAGCTGTTGTTACCC
GAGTTGATAAGCCCCAAAAAAGATCGGCACAACTCATTCCTTCTCCAGTA
AAAACTATAGCTCTAACTCACGGTCTACCTTTACTCCAACCTAGTAAAGC
GTCAGACCCCCAATTTATTGAAGAACTTCGGGCTTTTAATGCTGATGTTT
TTATTGTGGTTGCCTATGGAGCGATTCTTCGTCAGATAGTCCTCGATATT
CCTCGTTATGGTTGTTACAATCTGCATGCAGGGCTCTTGCCAGCCTACCG
AGGCGCAGCTCCCATACAACGCTGTATTATGGAAGGAGCTACAGAATCTG
GAAATACTGTCATCCGTATGGATGCAGGTATGGATACAGGCGACATGGCA
AATATTACGCGTGTCCCCATAGGTCCTGATATGACTTCAGGAGAATTGGC
GGATGCTCTTGCATCGCAGGGCGCAGAAGTTCTAATAAAAACTTTACAAC
AAATTGAGTCAGGTCAACTGCAACTCGTCAGTCAAGACGCTGCTTTGGCG
ACAATAGCGCCAAAATTGTCTAAGGAAGAAGGACAGGTTCCTTGGGATAA
ACCTGCTAAAGAGGCTTATGCTCATATACGAGGAGTCACGCCAGCTCCAG
GAGCGTGGACCCTATTCTCTTTTTCTGAAAAAGCGCCAAAACGCTTGATG
ATCCGTAAGGCCTCTCTTTTAGCAGAGGCGGGAAGATATGGAGCCCCCGG
GACTGTTGTTGTAACAGATAGGCAAGAGCTTGCTATTGCCTGTTCTGAGG
GAGCCATTTGCTTGCACGAAGTGCAGGTAGAAGGCAAGGGTTCTACGAAC
TCAAAATCCTTTTTAAACGGCTATCCAGCAAAGAAATTAAAAATAGTTTT
TACTTTAAATAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy