Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR510 IGR517 IGR516 IGR508 IGR512 IGR509 IGR511 IGR507 IGR518 IGR513 IGR515 IGR514 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 rl16, - CPn0640 fabZ, - CPn0651 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 rl16, - CPn0640 fabZ, - CPn0651 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rl22, - CPn0642 rl23, - CPn0645 rl16, - CPn0640 fabZ, - CPn0651 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 lpxA, - CPn0650 lpxA, - CPn0650 rs19, - CPn0643
* Calculated from Protein Sequence

Gene ID: CPn0648

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
731603

Gene Stop:
730602

Gene Length:
1002

Molecular Weight*:
35136

pI*:
10.40

Net Charge*:
18.10

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0648 is orthologously related to CT529: residues 38-322 of CPn0648 are 35% similar to residues 16-291 of CT529, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
170  
187
transmembrane  
206  
223
transmembrane  
298  
320

PDB Hit:


Gene Protein Sequence:
MATNAIRSAGSAASKMLLPVAKEPAAVSSFAQKGIYCIQQFFTNPGNKLA
KFVGATKSLDKCFKLSKAVSDCVVGSLEEAGCTGDALTSARNAQGMLKTT
REVVALANVLNGAVPSIVNSTQRCYQYTRQAFELGSKTKERKTPGEYSKM
LLTRGDYLLAASREACTAVGATTYSATFGVLRPLMLINKLTAKPFLDKAT
VGNFGTAVAGIMTINHMAGVAGAVGGIALEQKLFKRAKESLYNERCALEN
QQSQLSGDVILSAERALRKEHVATLKRNVLTLLEKALELVVDGVKLIPLP
ITVACSAAISGALTAASAGIGLYSIWQKTKSGK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGACTAACGCAATTAGATCGGCAGGAAGTGCAGCAAGTAAGATGCT
GCTGCCAGTTGCCAAAGAACCAGCGGCTGTCAGCTCCTTTGCTCAGAAAG
GGATTTATTGTATTCAACAATTTTTTACAAACCCTGGGAATAAGTTAGCA
AAGTTTGTAGGGGCAACAAAAAGTTTAGATAAATGCTTTAAGCTAAGTAA
GGCGGTTTCTGACTGTGTCGTAGGATCGCTGGAAGAGGCGGGATGCACAG
GGGACGCATTGACCTCCGCGAGAAACGCCCAGGGTATGTTAAAAACAACT
CGAGAAGTTGTTGCCTTAGCTAATGTGCTCAATGGAGCTGTTCCATCTAT
CGTTAACTCGACTCAGAGGTGTTACCAATACACACGTCAAGCCTTCGAGT
TAGGAAGCAAGACAAAAGAAAGAAAAACGCCTGGGGAGTATAGTAAAATG
CTATTAACTCGAGGTGATTACCTATTGGCAGCTTCCAGGGAAGCTTGTAC
GGCAGTCGGTGCAACGACTTACTCAGCGACATTCGGTGTTTTACGTCCGT
TAATGTTAATCAATAAACTCACAGCAAAACCATTCTTAGACAAAGCGACT
GTAGGCAATTTTGGCACGGCTGTTGCTGGAATTATGACCATTAATCATAT
GGCAGGAGTTGCTGGTGCTGTTGGCGGAATCGCATTAGAACAAAAGCTGT
TCAAACGTGCGAAGGAATCCCTATACAATGAGAGATGTGCCTTAGAAAAC
CAACAATCTCAGTTGAGTGGGGACGTGATTCTAAGCGCGGAAAGGGCATT
ACGTAAAGAACACGTTGCTACTCTAAAAAGAAATGTTTTAACTCTTCTTG
AAAAAGCTTTAGAGTTGGTAGTGGATGGAGTCAAACTCATTCCTTTACCG
ATTACAGTGGCTTGCTCCGCTGCAATTTCTGGAGCCTTGACGGCAGCATC
CGCAGGAATTGGCTTATATAGCATATGGCAGAAAACAAAGTCTGGCAAAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy