Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR506 IGR510 IGR517 IGR516 IGR504 IGR508 IGR512 IGR509 IGR511 IGR505 IGR507 IGR518 IGR513 IGR515 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl16, - CPn0640 fabZ, - CPn0651 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl16, - CPn0640 fabZ, - CPn0651 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl16, - CPn0640 fabZ, - CPn0651 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 cutE,lnt, - CPn0653 rl29, - CPn0639 lpxA, - CPn0650 lpxA, - CPn0650 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 lpxC, - CPn0652 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0647

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl3  

Definition:
50S ribosomal protein L3

Gene Start:
730331

Gene Stop:
729654

Gene Length:
678

Molecular Weight*:
24282

pI*:
10.90

Net Charge*:
18.07

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
L3 binds 23S RNA.

Alignment with its ortholog CT528 in C. trachomatis
indicates the translation may start at the 7th
position as predicated here.

Blast Summary:  PSI-Blast Search
CPn0647 is similar to TP0189 in T. pallidum,
UU231 in U. urealyticum and MG151 in M. genitalium.

CPn0647 is orthologously related to CT528:
residues 7-222 are 72% similar to residues 1-216 of CT528.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0087
COG name: Ribosomal protein L3
Functional Class: J
The phylogenetic pattern of COG0087 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 17 to 220 (E-value = 2e-58) place CPn0647 in the Ribosomal_L3 family which is described as Ribosomal protein L3 (PF00297)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
74  
180
coil-coil  
181  
208

PDB Hit:


Gene Protein Sequence:
LLMDKFMRSHISVMGKKEGMIHIFDKDGSLVACSVIRVEPNVVTQIKTKE
SDGYFSLQIGAEEMNAPAHTITKRVSKPKLGHLRKAGGRVFRFLKEVRGS
EEALNGVSLGDAFGLEVFEDVSSVDVRGISKGKGFQGVMKKFGFRGGPGS
HGSGFHRHAGSIGMRSTPGRCFPGSKRPSHMGAENVTVKNLEVIKVDLEK
KVLLVKGAIPGARGSIVIVKHSSRT$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTAATGGATAAGTTTATGCGGTCTCATATTAGTGTGATGGGAAAAAA
AGAAGGGATGATTCACATCTTTGATAAAGATGGATCCTTGGTTGCTTGCT
CAGTAATTCGCGTTGAGCCTAACGTTGTTACCCAGATCAAAACTAAGGAA
AGCGACGGATATTTCTCCTTGCAAATAGGAGCGGAAGAAATGAATGCCCC
CGCTCATACAATTACAAAACGTGTTAGTAAGCCTAAACTCGGACATTTGC
GTAAAGCTGGTGGTCGAGTTTTTCGTTTTCTTAAAGAAGTCCGAGGTTCT
GAAGAGGCTCTTAATGGGGTGTCTTTGGGAGATGCTTTTGGATTGGAAGT
TTTTGAAGATGTTTCCTCAGTTGATGTTCGTGGAATTTCAAAAGGAAAAG
GTTTTCAAGGTGTCATGAAGAAATTTGGTTTTCGTGGCGGTCCAGGAAGC
CATGGTTCAGGGTTTCATCGTCATGCAGGTTCTATAGGAATGCGATCGAC
TCCTGGTCGTTGTTTCCCTGGAAGTAAGCGTCCTAGTCATATGGGCGCAG
AGAACGTTACTGTAAAAAATTTAGAAGTAATAAAAGTAGATTTAGAAAAA
AAAGTACTGTTAGTTAAAGGTGCCATTCCTGGAGCGCGAGGCTCTATTGT
TATAGTGAAACATTCTTCTAGAACTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy