Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR517 IGR516 IGR504 IGR508 IGR512 IGR509 IGR511 IGR505 IGR507 IGR513 IGR515 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl16, - CPn0640 fabZ, - CPn0651 rl5, - CPn0635 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl16, - CPn0640 fabZ, - CPn0651 rl5, - CPn0635 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl5, - CPn0635 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 lpxC, - CPn0652 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl29, - CPn0639 lpxA, - CPn0650 lpxA, - CPn0650 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 fabZ, - CPn0651 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0646

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl4  

Definition:
50S ribosomal protein L4

Gene Start:
729621

Gene Stop:
728947

Gene Length:
675

Molecular Weight*:
25051

pI*:
10.40

Net Charge*:
13.01

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
L4 binds to 23S RNA.

Blast Summary:  PSI-Blast Search
CPn0646 is similar to MG152 in M. genitalium,
UU232 in U. urealyticum and TP0190 in T. pallidum.

CPn0646 is orthologously related to CT527:
residues 1-224 are 72% similar to that of CT527.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0088
COG name: Ribosomal protein L4
Functional Class:  J
The phylogenetic pattern of COG0088 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 16 to 217 (E-value = 1.1e-68) place CPn0646 in the Ribosomal_L4 family which is described as Ribosomal protein L4/L1 family (PF00573)

PDB Hit:


Gene Protein Sequence:
MVLLSKFDFSGNKIGEVEVADSLFADEGDGLQLIKDYIVAIRANKRQWSA
CTRNRSEVSHSTKKPFKQKGTGNARQGCLASPQFRGGGIVFGPKPKFNQH
VRINRKERKAAIRLLLAQKIQTNKLTVVDDTVFVDALTAPKTQSALRFLK
DCNVECRSILFIDHLDHVEKNENLRLSLRNLTAVKGFVYGININGYDLAS
AHNIVISKKALQELVERLVSETKD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTATTATCAAAATTTGATTTTTCAGGAAATAAAATAGGCGAAGT
TGAAGTAGCAGACTCTTTGTTTGCAGATGAGGGCGATGGCCTTCAATTGA
TCAAGGATTATATTGTTGCTATTCGCGCGAATAAAAGACAGTGGTCTGCA
TGCACTAGAAATCGTTCTGAAGTGAGTCATTCTACAAAAAAACCTTTCAA
ACAAAAAGGTACGGGTAATGCCCGTCAGGGATGTTTAGCTTCTCCTCAGT
TTCGTGGGGGTGGGATTGTTTTTGGGCCTAAGCCTAAATTTAATCAACAC
GTACGTATAAACCGTAAAGAAAGAAAAGCCGCAATCAGGCTTTTGTTGGC
GCAAAAAATTCAAACAAACAAATTGACTGTAGTTGACGATACGGTCTTTG
TAGATGCTTTAACAGCTCCTAAAACTCAGTCAGCGTTAAGGTTTTTAAAA
GATTGCAATGTTGAGTGTCGTAGCATTCTCTTTATTGATCACTTAGATCA
TGTAGAGAAGAATGAAAATTTAAGATTAAGTTTGCGTAACCTCACTGCAG
TTAAGGGTTTTGTCTATGGAATCAATATCAATGGGTATGACTTAGCTTCT
GCTCATAATATTGTTATTTCTAAAAAAGCTTTGCAGGAACTTGTTGAGCG
TCTTGTTTCTGAAACGAAAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy