Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR516 IGR504 IGR508 IGR512 IGR502 IGR509 IGR511 IGR505 IGR501 IGR507 IGR513 IGR515 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rs8, - CPn0634 rl16, - CPn0640 fabZ, - CPn0651 rl5, - CPn0635 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rs8, - CPn0634 rl16, - CPn0640 fabZ, - CPn0651 rl5, - CPn0635 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rs8, - CPn0634 rl5, - CPn0635 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl29, - CPn0639 lpxA, - CPn0650 lpxA, - CPn0650 rl16, - CPn0640 fabZ, - CPn0651 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0645

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl23  

Definition:
50S ribosomal protein L23

Gene Start:
728930

Gene Stop:
728595

Gene Length:
336

Molecular Weight*:
12408

pI*:
10.90

Net Charge*:
14.89

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
L23 binds 23S RNA.

Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0645 is orthologously related to CT526 and
they share 78% similarity.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0089
COG name: Ribosomal protein L23
Functional Class:  J
The phylogenetic pattern of COG0089 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKDPYDVIKRHYVTEKAKMLEHLSAGTGEGKKKGSFCKDPKFVFIVSHDA
TKPLIAQALEAIYVDKNVKVKSVNTINVKPQPARMFRGRRKGKTSGFKKA
IVTFYQGHSVG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGATCCTTATGATGTAATTAAGCGTCACTACGTAACAGAGAAAGC
TAAAATGTTAGAGCATTTAAGCGCTGGAACTGGAGAGGGAAAGAAAAAGG
GAAGCTTTTGTAAAGACCCTAAATTTGTTTTTATAGTCTCTCATGATGCA
ACAAAGCCATTAATCGCCCAAGCTTTAGAGGCAATTTACGTTGATAAAAA
TGTAAAAGTAAAGAGTGTGAACACCATAAATGTAAAACCTCAACCCGCCC
GCATGTTTCGAGGGCGCCGTAAAGGAAAAACCTCAGGATTTAAGAAAGCA
ATTGTAACTTTCTATCAAGGGCACTCTGTCGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy