Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR502 IGR499 IGR509 IGR511 IGR505 IGR501 IGR507 IGR513 IGR515 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 rl24, - CPn0636 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 rl24, - CPn0636 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl29, - CPn0639 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl18, - CPn0632 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0643

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs19  

Definition:
30S ribosomal protein S19

Gene Start:
727713

Gene Stop:
727447

Gene Length:
267

Molecular Weight*:
10154

pI*:
11.40

Net Charge*:
12.42

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
S19 apparently forms a complex with S13.

Blast Summary:  PSI-Blast Search
CPn0643 is similar to MG155 in M. genitalium,
UU235 in U. urealyticum and TP0193 in T. pallidum.

CPn0643 is orthologously related to CT524 and
they share 93% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0185
COG name: Ribosomal protein S19
Functional Class:  J
The phylogenetic pattern of COG0185 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 83 (E-value = 3.1e-45) place CPn0643 in the Ribosomal_S19 family which is described as Ribosomal protein S19 (PF00203)

PDB Hit:


Gene Protein Sequence:
MGRSLRKGPFVDHHLLKKVRAMNIEEKKTPIKTWSRRSMITPEMIGHTFE
VHNGKKFLTVFVSETMVGHKLGEFSPTRIFKSHPVKKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAGATCGTTAAGAAAAGGTCCGTTTGTTGATCACCACCTCCTAAA
AAAAGTGCGTGCAATGAACATAGAGGAGAAAAAAACTCCTATCAAAACAT
GGTCTCGTCGTTCAATGATTACTCCTGAGATGATCGGCCATACGTTTGAA
GTTCACAACGGGAAGAAATTTTTAACCGTATTTGTTTCAGAAACTATGGT
GGGTCATAAATTAGGAGAATTTTCTCCCACAAGGATATTTAAAAGCCATC
CTGTGAAGAAAGGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy