Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR502 IGR499 IGR509 IGR511 IGR505 IGR501 IGR507 IGR513 IGR515 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 rl24, - CPn0636 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl23, - CPn0645 rl24, - CPn0636 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl22, - CPn0642 rl23, - CPn0645 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0642

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl22  

Definition:
50S ribosomal protein L22

Gene Start:
727428

Gene Stop:
727093

Gene Length:
336

Molecular Weight*:
12412

pI*:
11.50

Net Charge*:
14.42

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The L22 protein is said to be important for
early stages of 50S reconstitution.

Blast Summary:  PSI-Blast Search
CPn0642 is similar to TP0194 in T. pallidum,
UU236 in U. urealyticum and MG156 in M. genitalium.

CPn0642 is orthologously related to CT523:
residues 1-109 are 82% similar to that of CT523.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0091
COG name: Ribosomal protein L22
Functional Class:  J
The phylogenetic pattern of COG0091 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 108 (E-value = 8.4e-22) place CPn0642 in the Ribosomal_L22 family which is described as Ribosomal protein L22p/L17e (PF00237)

PDB Hit:


Gene Protein Sequence:
MFKATARYIRVQPRKARLAAGLMRNLSVQEAEEQLGFSQLKAGRCLKKVL
NSAVANAELHENIKRENLSVTEVRVDAGPVYKRSKSKSRGGRSPILKRTS
HLTVIVGEKER$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAAAGCGACCGCCCGATATATTCGGGTACAACCTCGTAAAGCTAG
ATTAGCTGCTGGGCTTATGAGAAATCTAAGTGTGCAAGAGGCTGAGGAAC
AGCTGGGATTTTCTCAGTTGAAAGCTGGAAGATGTTTAAAAAAGGTTTTA
AATAGCGCTGTAGCTAATGCTGAATTGCATGAAAATATAAAGCGTGAAAA
TTTAAGCGTTACCGAAGTTCGAGTAGATGCCGGGCCTGTCTACAAGCGAT
CTAAATCAAAAAGTAGAGGAGGACGCTCTCCTATTTTAAAACGTACCAGT
CACTTGACTGTTATTGTTGGTGAGAAGGAACGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy