Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR502 IGR499 IGR509 IGR511 IGR505 IGR498 IGR501 IGR507 IGR513 IGR515 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 fmt, - CPn0649 CPn0648 secY, - CPn0629 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 CPn0648 rl29, - CPn0639 rl15, - CPn0630 rl16, - CPn0640 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 fmt, - CPn0649 rl15, - CPn0630 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0641

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs3  

Definition:
30S ribosomal protein S3

Gene Start:
727077

Gene Stop:
726406

Gene Length:
672

Molecular Weight*:
24598

pI*:
10.90

Net Charge*:
17.10

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The S3 protein is apparently involved in the
binding of initiator Met-tRNA.

Blast Summary:  PSI-Blast Search
CPn0641 is similar to TP0195 in T. pallidum,
UU237 in U. urealyticum and MG157 in M. genitalium.

CPn0641 is orthologously related to CT522 and
they share 83% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0092
COG name: Ribosomal protein S3
Functional Class:  J
The phylogenetic pattern of COG0092 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 62 (E-value = 3.6e-13) place CPn0641 in the Ribosomal_S3_N family which is described as Ribosomal protein S3, N-terminal domain (PF00417)
Residues 65 to 112 (E-value = 2.6e-05) place CPn0641 in the KH family which is described as KH domain (PF00013)
Residues 119 to 202 (E-value = 9.1e-51) place CPn0641 in the Ribosomal_S3_C family which is described as Ribosomal protein S3, C-terminal domain (PF00189)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
51  
137

PDB Hit:


Gene Protein Sequence:
MGQKGCPIGFRTGVTKRWRSLWYGNKQEFGKFLIEDVRIRQFLRKKPSCQ
GAAGFVVRRMSGKIEVTIQTARPGLVIGKKGAEVDLLKEELRALTGKEVW
LEIAEIKRPELNAKLVADNIARQIERRVSFRRAMKKAMQSVMDAGAVGVK
IQVSGRLAGAEIARSEWYKNGRVPLHTLRADIDYATACAETTYGIIGIKV
WINLGENSSSTTPNNPAAPSAAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTCAGAAAGGTTGTCCAATCGGATTTCGTACAGGGGTTACAAAAAG
ATGGCGTTCTCTTTGGTACGGAAATAAACAAGAATTTGGTAAATTTCTCA
TAGAAGATGTAAGAATTCGACAGTTTTTAAGAAAAAAACCTTCATGTCAA
GGTGCCGCTGGATTTGTTGTCCGTCGTATGAGTGGTAAAATTGAAGTGAC
CATCCAAACCGCTCGTCCTGGGTTGGTAATTGGAAAAAAAGGCGCTGAAG
TTGATCTGCTTAAAGAAGAGCTCAGAGCTCTTACCGGAAAAGAAGTCTGG
TTAGAAATCGCGGAAATTAAACGTCCCGAACTAAATGCAAAATTAGTAGC
TGATAACATTGCAAGACAAATTGAACGTCGAGTCTCTTTTAGACGGGCTA
TGAAAAAGGCAATGCAATCAGTAATGGATGCTGGAGCTGTTGGTGTAAAA
ATTCAAGTTTCAGGCAGGTTAGCAGGAGCCGAGATTGCTCGTTCTGAATG
GTATAAAAATGGCCGTGTGCCGCTTCATACGCTAAGAGCTGACATTGATT
ATGCTACAGCTTGTGCGGAAACTACCTACGGAATTATCGGTATAAAAGTT
TGGATTAATCTTGGAGAGAACTCCTCTTCTACAACTCCTAACAATCCGGC
AGCACCCTCTGCAGCTGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy