Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR499 IGR502 IGR509 IGR511 IGR505 IGR498 IGR501 IGR507 IGR513 IGR514 rs17, - CPn0638 rs19, - CPn0643 rl23, - CPn0645 rl24, - CPn0636 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 CPn0648 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl23, - CPn0645 rl24, - CPn0636 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 CPn0648 secY, - CPn0629 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 CPn0648 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl3, - CPn0647 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0638

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs17  

Definition:
30S ribosomal protein S17

Gene Start:
725747

Gene Stop:
725487

Gene Length:
261

Molecular Weight*:
9872

pI*:
11.20

Net Charge*:
12.71

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The S17 protein is thought to bind directly to
the 5' end of 16S RNA. See Kaul et al., J.Bact.174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0638 is similar to MG160 in M. genitalium,
UU240 in U. urealyticum and TP0198 in T. pallidum.

CPn0638 is orthologously related to CT519:
residues 1-82 are 76% similar to that of CT519.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0186
COG name: Ribosomal protein S17
Functional Class:  J
The phylogenetic pattern of COG0186 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 14 to 81 (E-value = 5e-32) place CPn0638 in the Ribosomal_S17 family which is described as Ribosomal protein S17 (PF00366)

PDB Hit:


Gene Protein Sequence:
MASEPRGSRKVKIGVVVSAKMEKTVVVRVERIFSHPQYLKVVRSSKKYYA
HTELKVSEGDKVKIQETRPLSKLKRWRVIEHVGVVS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAGTGAACCAAGAGGCTCTAGAAAAGTTAAGATTGGTGTTGTTGT
CTCGGCAAAAATGGAAAAAACTGTCGTTGTTCGAGTAGAAAGGATATTTT
CTCATCCTCAGTATCTTAAAGTAGTGAGAAGTTCAAAGAAATATTACGCT
CACACTGAACTAAAAGTTTCTGAAGGGGATAAAGTTAAAATTCAAGAAAC
ACGACCTTTGTCTAAGCTTAAAAGATGGCGCGTTATAGAACATGTTGGCG
TGGTAAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy