Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR502 IGR499 IGR509 IGR511 IGR505 IGR498 IGR501 IGR507 IGR513 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 secY, - CPn0629 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0637

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl14  

Definition:
50S ribosomal protein L14

Gene Start:
725464

Gene Stop:
725096

Gene Length:
369

Molecular Weight*:
13453

pI*:
10.90

Net Charge*:
12.08

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The L14 protein is thought to directly bind to
23S RNA. See Kaul et al., J.Bact. 174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0637 is similar to TP0199 in T. pallidum,
UU241 in U. urealyticum and MG161 in M. genitalium.

CPn0637 is orthologously related to CT518 and
they share 92% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0093
COG name: Ribosomal protein L14
Functional Class:  J
The phylogenetic pattern of COG0093 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 122 (E-value = 3.8e-79) place CPn0637 in the Ribosomal_L14 family which is described as Ribosomal protein L14p/L23e (PF00238)

PDB Hit:


Gene Protein Sequence:
MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRDVEPNS
SIKKGDVIKAVIVRTRRHITRKDGSTLKFDTNSCVIIDDKGNPKGTRIFG
PVAREIRDRGFIKISSLAPEVI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCAGCAAGAAAGTCAGTTAAAAGTTGCCGATAATACTGGAGCTAA
AAAAGTAAAATGCTTCAAGGTTCTTGGAGGTTCTCGTAGACGTTATGCTA
CTGTCGGAGATGTCATTGTATGCTCAGTTAGAGATGTCGAACCTAATAGT
TCTATAAAAAAGGGAGACGTTATCAAAGCTGTGATCGTGCGCACACGTCG
GCATATTACAAGAAAAGATGGGTCTACTTTAAAATTTGATACAAATAGCT
GTGTAATTATCGATGATAAAGGAAATCCTAAAGGAACAAGGATTTTTGGC
CCCGTAGCTCGAGAAATTCGAGATAGAGGTTTTATAAAAATTAGTTCTTT
AGCTCCTGAGGTAATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy