Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR499 IGR502 IGR509 IGR511 IGR496 IGR505 IGR498 IGR501 IGR507 IGR513 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl23, - CPn0645 rl22, - CPn0642 rl24, - CPn0636 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl23, - CPn0645 rl22, - CPn0642 rl24, - CPn0636 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 secY, - CPn0629 rl23, - CPn0645 rl22, - CPn0642 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl3, - CPn0647 rl2, - CPn0644 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rs13, - CPn0628 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0636

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl24  

Definition:
50S ribosomal protein L24

Gene Start:
725082

Gene Stop:
724747

Gene Length:
336

Molecular Weight*:
12409

pI*:
11.30

Net Charge*:
14.23

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
RL24 is believed to be involved in the early
assembly of the 50S subunit.
See Kaul et al., J.Bact. 174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0636 is similar to TP0200 T. pallidum, MG162
in M. genitalium and UU242 in U. urealyticum.

CPn0636 is orthologously related to CT517 and they
share 68% similarity.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0198
COG name: Ribosomal protein L24
Functional Class:  J
The phylogenetic pattern of COG0198 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 37 (E-value = 5.2e-08) place CPn0636 in the KOW family which is described as KOW motif (PF00467)

PDB Hit:


Gene Protein Sequence:
MKKQNIRVGDKVFILAGNDKGKEGKVLSLTEDKVVVEGVNVRIKNIKRSQ
QNPKGKRISIEAPIHISNVRLTIAGEPAKLSVKVTEQGRELWQRRPDGTS
QLYRLVRGKKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGCAAAACATTCGTGTTGGTGATAAGGTATTTATATTAGCTGG
TAATGATAAAGGAAAAGAAGGAAAAGTCCTTTCTCTTACTGAAGATAAAG
TAGTTGTCGAAGGTGTAAACGTTCGCATAAAAAATATAAAACGTAGTCAA
CAAAATCCTAAAGGTAAACGGATTAGTATAGAGGCTCCTATCCATATTTC
TAATGTACGTTTAACCATAGCTGGTGAACCTGCCAAACTCTCTGTCAAAG
TGACTGAACAGGGGCGGGAGTTGTGGCAAAGACGCCCTGACGGAACATCC
CAGCTGTATCGTCTAGTGAGGGGAAAGAAAGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy