Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR502 IGR499 IGR509 IGR495 IGR496 IGR511 IGR505 IGR498 IGR501 IGR507 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rl22, - CPn0642 rl23, - CPn0645 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rs11, - CPn0627 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0635

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl5  

Definition:
50S ribosomal protein L5

Gene Start:
724745

Gene Stop:
724203

Gene Length:
543

Molecular Weight*:
20537

pI*:
10.50

Net Charge*:
11.09

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
See Kaul et al., J.Bact. 174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0635 is similar to TP0201 in T. pallidum, UU243
in U. urealyticum and MG163 in M. genitalium.

CPn0635 is orthologously related to CT516 and they share 88% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0094
COG name: Ribosomal protein L5
Functional Class:  J
The phylogenetic pattern of COG0094 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 24 to 80 (E-value = 2.3e-31) place CPn0635 in the Ribosomal_L5 family which is described as Ribosomal protein L5 (PF00281)
Residues 84 to 177 (E-value = 4.7e-29) place CPn0635 in the Ribosomal_L5_C family which is described as ribosomal L5P family C-terminus (PF00673)

PDB Hit:


Gene Protein Sequence:
MSRLKKFYTEEIRKSLFEKFGYANKMQIPVLKKIVLSMGLAEAAKDKNLF
QAHLEELTMISGQKPLVTKARNSIAGFKLREGQGIGAKVTLRGIRMYDFM
DRFCNIVSPRIRDFRGFSNKGDGRGCYSVGLDDQQIFPEINLDRVKRTQG
LNITWVTTAQTDDECTTLLELMGLRFKKAQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAGATTAAAAAAATTCTATACTGAAGAAATTCGCAAATCTTTGTT
TGAAAAGTTTGGCTATGCAAATAAAATGCAGATCCCTGTTCTTAAAAAAA
TTGTCTTAAGTATGGGACTTGCTGAAGCCGCTAAAGATAAAAATTTATTC
CAAGCCCACTTAGAAGAATTGACCATGATCTCTGGGCAAAAACCGTTAGT
AACAAAAGCTCGAAATTCTATTGCCGGTTTTAAATTACGAGAAGGTCAAG
GAATCGGTGCAAAAGTTACCCTTCGTGGAATTCGTATGTACGATTTTATG
GATCGTTTCTGTAATATTGTTTCTCCACGGATTCGCGACTTCCGCGGATT
TTCTAATAAAGGAGACGGAAGGGGTTGCTATTCTGTAGGATTAGACGATC
AACAAATTTTCCCAGAAATTAATTTAGATCGTGTGAAGCGCACCCAGGGA
TTGAATATCACATGGGTAACTACCGCGCAAACAGATGATGAGTGCACCAC
TCTATTAGAGTTGATGGGCTTACGATTTAAGAAAGCTCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy