Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR500 IGR504 IGR508 IGR512 IGR502 IGR499 IGR509 IGR495 IGR496 IGR511 IGR505 IGR498 IGR501 IGR507 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rl23, - CPn0645 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rl22, - CPn0642 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl4, - CPn0646 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl23, - CPn0645 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0634

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs8  

Definition:
30S ribosomal protein S8

Gene Start:
724185

Gene Stop:
723784

Gene Length:
402

Molecular Weight*:
15101

pI*:
10.80

Net Charge*:
11.14

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The S8 protein is thought to bind the 16S RNA.
See Kaul et al., J.Bact.
174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0634 is similar to TP0203 in T. pallidum, MG165 in M. genitalium and UU245 in U. urealyticum.

CPn0634 is orthologously related to CT515 and
they share 85% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0096
COG name: Ribosomal protein S8
Functional Class:  J
The phylogenetic pattern of COG0096 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 133 (E-value = 7.9e-63) place CPn0634 in the Ribosomal_S8 family which is described as Ribosomal protein S8 (PF00410)

PDB Hit:


Gene Protein Sequence:
MGMTSDSIADLLTRIRNALMAEHLYVDVEHSKMREAIVKILKHKGFVAHY
LVKEENRKRAMRVFLQYSDDRKPVIHQLKRVSKPSRRVYVSAAKIPYVFG
NMGISVLSTSQGVMEGSLARSKNIGGELLCLVW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCATGACAAGTGATTCTATAGCAGATTTGTTAACGCGAATTCGTAA
CGCTTTGATGGCAGAACATCTGTATGTAGACGTAGAGCACAGTAAAATGC
GAGAGGCTATTGTAAAAATCCTCAAGCATAAAGGTTTTGTGGCTCATTAT
TTAGTAAAGGAAGAAAACCGCAAACGCGCTATGCGTGTGTTTTTACAATA
TTCCGATGATCGTAAACCAGTAATACACCAACTGAAACGGGTATCAAAAC
CCTCTCGAAGAGTCTATGTATCGGCTGCGAAAATCCCTTACGTCTTTGGA
AATATGGGAATTTCAGTCCTCTCCACTTCTCAGGGAGTTATGGAAGGTTC
TCTAGCCAGATCTAAGAATATTGGGGGCGAATTGCTCTGTTTGGTGTGGT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy