Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR494 IGR500 IGR504 IGR508 IGR499 IGR502 IGR509 IGR495 IGR496 IGR505 IGR498 IGR501 IGR507 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl24, - CPn0636 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl24, - CPn0636 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rl22, - CPn0642 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl2, - CPn0644 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl17, - CPn0625 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0633

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl6  

Definition:
50S ribosomal protein L6

Gene Start:
723757

Gene Stop:
723206

Gene Length:
552

Molecular Weight*:
20084

pI*:
10.70

Net Charge*:
13.91

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The L6 protein binds the 23S ribosomal RNA. It
was falsely considered to be
chlanectin; see Kaul et al. J.Bact.169:5152
(1987), Kaul et al., J.Bact.
174:1205 (1992), Gray et al., J.Bact. 173:1663
(1991).

Blast Summary:  PSI-Blast Search
CPn0633 is similar to MG166 in M. genitalium, TP0204 in T. pallidum and UU246 in U. urealyticum.

CPn0633 is orthologously related to CT514 and
they share 81% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0097
COG name: Ribosomal protein L6
Functional Class:  J
The phylogenetic pattern of COG0097 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 83 (E-value = 4.2e-14) place CPn0633 in the Ribosomal_L6 family which is described as Ribosomal protein L6 (PF00347)
Residues 91 to 166 (E-value = 2.8e-27) place CPn0633 in the Ribosomal_L6 family which is described as Ribosomal protein L6 (PF00347)

PDB Hit:


Gene Protein Sequence:
MSRKAREPILLPQGVEVSIQDDKIIVKGPKGSLTQKSVKEVEITLKDNSI
FVHAAPHVVDRPSCMQGLYWALISNMVQGVHLGFEKRLEMIGVGFRASVQ
GAFLDLSIGVSHPTKIPIPSTLQVSVEKNTLISVKGLDKQLVGEFAASIR
AKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCGTAAGGCTCGAGAACCTATTCTACTTCCTCAAGGAGTAGAAGT
TTCGATTCAAGATGATAAAATTATTGTAAAAGGTCCTAAAGGGTCCTTAA
CACAGAAATCGGTCAAAGAAGTAGAAATCACCTTAAAAGATAACAGTATA
TTTGTACACGCAGCTCCCCATGTTGTCGATAGACCTAGCTGTATGCAGGG
GTTATATTGGGCGCTCATTTCAAATATGGTTCAAGGTGTCCATTTAGGAT
TTGAAAAACGTTTAGAAATGATTGGAGTGGGTTTCAGAGCCTCTGTTCAA
GGTGCATTTTTGGATCTCTCCATTGGGGTTTCTCACCCTACAAAAATTCC
TATCCCATCTACTCTTCAGGTATCAGTTGAAAAAAATACTCTGATTTCAG
TGAAAGGGCTTGATAAGCAGTTGGTTGGTGAATTTGCTGCAAGTATTCGC
GCCAAACGTCCTCCTGAACCTTATAAAGGTAAGGGAATTCGTTATGAAAA
TGAATATGTCCGTCGTAAAGCTGGTAAAGCTGCGAAAACAGGCAAAAAAT
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy