Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR510 IGR494 IGR500 IGR504 IGR508 IGR499 IGR502 IGR509 IGR495 IGR496 IGR505 IGR498 IGR501 IGR507 IGR493 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl2, - CPn0644 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl22, - CPn0642 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl2, - CPn0644 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl22, - CPn0642 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl16, - CPn0640 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 rl2, - CPn0644 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl17, - CPn0625 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0632

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl18  

Definition:
50S ribosomal protein L18

Gene Start:
723195

Gene Stop:
722824

Gene Length:
372

Molecular Weight*:
13620

pI*:
11.30

Net Charge*:
16.41

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
See Kaul et al., J.Bact. 174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0632 is similar to TP0205 in T. pallidum, UU247
in U. urealyticum and MG167 in M. genitalium.

CPn0632 is orthologously related to CT513:
residues 1-123 are 75% similar to that of CT513.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0256
COG name: Ribosomal protein L18
Functional Class:  J
The phylogenetic pattern of COG0256 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 123 (E-value = 4.5e-46) place CPn0632 in the Ribosomal_L18p family which is described as Ribosomal L18p/L5e family (PF00861)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
123

PDB Hit:


Gene Protein Sequence:
MESSLCKKSLMKRRRALRVRKVLKGSPTKPRLSVVKTNKHIYVQLIDDSI
GKTLASVSTLSKLNKSQGLTKKNQEVAKVLGTQIAELGKNLQLDRVVFDR
GPFKYHGIVSMVADGAREGGLQF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAGTTCGTTATGTAAAAAGTCATTAATGAAAAGACGAAGAGCTTT
GCGAGTGCGTAAAGTATTAAAAGGTTCCCCTACAAAGCCTCGTTTGTCCG
TAGTGAAAACAAATAAACATATTTATGTACAGTTGATAGACGATTCTATC
GGCAAGACGTTGGCTTCCGTTTCCACTCTATCAAAATTAAATAAGAGTCA
AGGTCTGACTAAAAAAAACCAAGAAGTTGCTAAAGTATTAGGAACTCAAA
TTGCTGAATTGGGAAAAAACCTTCAACTTGATCGAGTTGTTTTCGATCGC
GGTCCTTTCAAATATCACGGAATTGTTTCTATGGTAGCTGATGGGGCTAG
AGAGGGTGGTTTACAGTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy