Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR494 IGR500 IGR504 IGR508 IGR499 IGR502 IGR509 IGR495 IGR496 IGR505 IGR498 IGR501 IGR507 IGR493 IGR497 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl24, - CPn0636 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rs19, - CPn0643 rl22, - CPn0642 rl24, - CPn0636 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl22, - CPn0642 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rs19, - CPn0643 rl24, - CPn0636 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0631

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs5  

Definition:
30S ribosomal protein S5

Gene Start:
722806

Gene Stop:
722309

Gene Length:
498

Molecular Weight*:
17653

pI*:
10.70

Net Charge*:
11.91

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0631 is similar to TP0206 in T.pallidum,
MG168 in M. genitalium and UU248 in U. urealyticum.

CPn0631 is orthologously related to CT512:
residues 1-165 are 84% similar to that of CT512.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0098
COG name: Ribosomal protein S5
Functional Class:  J
The phylogenetic pattern of COG0098 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 12 to 78 (E-value = 4e-36) place CPn0631 in the Ribosomal_S5 family which is described as Ribosomal protein S5, N-terminal domain (PF00333)
Residues 88 to 161 (E-value = 2.2e-35) place CPn0631 in the Ribosomal_S5_C family which is described as Ribosomal protein S5, C-terminal domain (PF03719)

PDB Hit:


Gene Protein Sequence:
MSLSKNSHKEDQLEEKVLVVNRCSKVVKGGRKFSFSALILVGDGKGRLGY
GFAKANELTDAIRKGGEAAKKNLMKIEALEDGSIPHEVLVHHDGAQLLLK
PAKPGTGIVAGSRIRLILEMAGIKDIVAKSFGSNNPMNQVKAAFKALTGL
SPRKDLLRRGAAIND$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGCTATCAAAGAATTCTCATAAAGAAGATCAATTAGAAGAGAAAGT
TCTTGTTGTTAACCGTTGCTCCAAAGTTGTTAAGGGAGGACGAAAGTTCA
GTTTTTCTGCTTTAATTTTAGTAGGAGATGGCAAGGGTCGTTTGGGCTAT
GGTTTTGCTAAAGCCAATGAACTCACAGATGCCATTCGTAAAGGTGGTGA
AGCTGCAAAAAAGAATTTAATGAAGATAGAAGCTTTAGAAGATGGTTCTA
TTCCTCATGAAGTTCTTGTCCATCACGATGGAGCACAGTTGCTGTTAAAA
CCAGCAAAACCTGGAACTGGAATTGTTGCCGGTTCTCGTATTCGTTTGAT
CCTAGAAATGGCTGGTATTAAAGATATTGTAGCTAAAAGTTTCGGATCTA
ATAACCCTATGAACCAAGTGAAAGCGGCGTTTAAAGCTCTTACAGGACTC
AGCCCACGTAAGGATTTGTTAAGAAGAGGAGCGGCTATAAATGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy