Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR494 IGR500 IGR504 IGR508 IGR502 IGR499 IGR495 IGR496 IGR505 IGR498 IGR501 IGR507 IGR493 IGR497 rs17, - CPn0638 rl22, - CPn0642 rl24, - CPn0636 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rl22, - CPn0642 rl24, - CPn0636 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs13, - CPn0628 rl14, - CPn0637 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 rs3, - CPn0641 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rs17, - CPn0638 rl22, - CPn0642 rl24, - CPn0636 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0630

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl15  

Definition:
50S ribosomal protein L15

Gene Start:
722316

Gene Stop:
721882

Gene Length:
435

Molecular Weight*:
15983

pI*:
11.20

Net Charge*:
15.66

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The L15 protein is thought to bind directly to
the 23S ribosomal RNA. Se
Kaul et al., J. Bact. 174:1205 (1992).

Blast Summary:  PSI-Blast Search
CPn0630 is similar to TP0207 in T. pallidum,
UU249 in U. urealyticum and MG169. in M. genitalium.

CPn0630 is orthologously related to CT511:
residues 1-141 are 75% similar to that of CT511.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0200
COG name: Ribosomal protein L15
Functional Class:  J
The phylogenetic pattern of COG0200 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 105 (E-value = 3.9e-52) place CPn0630 in the Ribosomal_L15 family which is described as Ribosomal protein L15 amino terminal region (PF01305)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
74

PDB Hit:


Gene Protein Sequence:
MIKLESLFDISERKRRKKLLGRGPSSGHGKTSGRGHKGDGSRSGYKRRFG
YEGGGVPLYRRVPTRGFSHKRFDKCVEEITTGRLAELFQEGEAITLDALK
AKKAIARQAVRVKVILKGDLEKTFVWQDTAVVLSQGVQNLLGIT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAGTTAGAATCATTATTTGATATTTCTGAACGTAAACGAAGAAA
AAAATTATTAGGTCGTGGTCCTTCTTCCGGTCATGGGAAAACCAGTGGTC
GTGGTCATAAAGGAGACGGTAGCCGTTCGGGATACAAACGTCGTTTTGGC
TATGAAGGGGGAGGAGTTCCTTTATATAGAAGAGTTCCTACAAGAGGGTT
TTCTCATAAACGTTTTGATAAATGCGTTGAAGAAATTACTACAGGACGTT
TAGCCGAGCTTTTCCAAGAAGGAGAAGCAATTACTTTAGATGCATTAAAA
GCAAAGAAAGCCATTGCGAGACAAGCTGTACGAGTCAAAGTCATTCTCAA
AGGAGATTTGGAAAAGACTTTTGTATGGCAAGATACTGCTGTAGTCCTAT
CGCAAGGAGTACAAAATTTGCTAGGCATTACTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy