Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR503 IGR506 IGR494 IGR500 IGR504 IGR492 IGR502 IGR499 IGR495 IGR496 IGR505 IGR498 IGR501 IGR493 IGR497 rs17, - CPn0638 rl24, - CPn0636 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs17, - CPn0638 rl24, - CPn0636 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl16, - CPn0640 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl29, - CPn0639 rl15, - CPn0630 rl15, - CPn0630 rl16, - CPn0640 rl24, - CPn0636 rs17, - CPn0638 rl29, - CPn0639
* Calculated from Protein Sequence

Gene ID: CPn0629

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
secY  

Definition:
protein translocase SecY subunit

Gene Start:
721857

Gene Stop:
720484

Gene Length:
1374

Molecular Weight*:
50275

pI*:
10.80

Net Charge*:
18.57

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:
SecY is one of seven prokaryotic secretory proteins that facilitate protein translocation across the plasma membrane; it is an integral membrane protein. See CT448 for the secF and secD sequences. CT701 appears to be the secA sequence.
See CT510.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to preprotein translocase SecY sequences; e.g. residues 1-456 are 83% similar to CT510; residues 8-447 are 37% similar to TP0208; residues 17-430 are 35% similar to MG170; residues 17-430 are 31% similar to UU250; residues 1-449 are 34% similar to SECY_STRGB; and residues 1-449 are 33% similar to SECY_STRSC.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0201
COG name: Preprotein translocase subunit SecY
Functional Class:  N
The phylogenetic pattern of COG0201 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 23-376 span five regions of similarity to blocks BL00755A-E (Protein secY proteins) with a combined E-value of 2.1e-64.

ProDom Summary:  Protein Domain Search
Residues 12-194 are 83% similar to a defined domain of SECY_CHLTR, defined as: PROTEIN TRANSPORT SUBUNIT TRANSMEMBRANE TRANSLOCATION SECY PREPROTEIN TRANSLOCASE ENDOPLASMIC RETICULUM.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 73 to 434 (E-value = 5.8e-184) place CPn0629 in the SecY family which is described as eubacterial secY protein (PF00344)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
23  
42
transmembrane  
67  
91
transmembrane  
121  
144
transmembrane  
149  
173
transmembrane  
195  
212
transmembrane  
232  
253
transmembrane  
284  
305
transmembrane  
322  
343
transmembrane  
387  
404
transmembrane  
413  
430

PDB Hit:


Gene Protein Sequence:
MTTLRQFFLITELRQKLFYTFALLTACRVGVFIPVPGINGELAVAYFKQL
LGSGQNLFQLADIFSGGAFAQMTVIALGVVPYISASIIVQLFLVFMPALQ
REMRESSDQGKRRIGRLTRLFTVALAVIQSLLFAKFALRMNLTIPGIVLP
TLLSSKLFGVPWIFYITTVVVMTTGTLLLMWIGEQISDKGIGNGISLIIA
LGILSSFPSVLGSIVNKLNLGSQDSSDLGLISILILALVFVFVLITTILI
IEGVRKIPVQYARRVIGRREVPGGGSYLPLKVNYAGVIPVIFASSLLMFP
ATIGQFIASESSWMKRIAALLAPGSLVYSICYVLLIIFFTYFWTATQFHP
EQIASEMKKNNAFIPGIRQGKPTQHYLEYTMNRVTLLGALFLAAIAILPS
LLGCLLRVDSNVSYFLGGTAMLIVVGVVLDTMKQVDAFLLMRRYDSVLKT
DRTKGRH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCACATTGAGACAATTTTTTCTGATTACCGAATTACGACAAAAGTT
ATTCTATACTTTTGCTTTGCTTACGGCCTGTAGAGTGGGTGTATTTATTC
CTGTTCCAGGAATTAATGGTGAATTAGCTGTAGCTTACTTCAAGCAGTTA
TTGGGATCAGGTCAGAATTTATTTCAACTAGCTGATATTTTTTCTGGAGG
CGCTTTTGCCCAAATGACCGTAATTGCGCTGGGTGTGGTTCCTTACATTT
CAGCCTCAATTATCGTTCAGCTGTTCCTAGTCTTTATGCCTGCGCTGCAA
AGAGAAATGAGGGAGTCTTCTGATCAAGGGAAACGTAGGATTGGTAGACT
CACACGTTTGTTTACCGTTGCTTTAGCTGTAATACAGTCTCTCTTATTTG
CTAAGTTTGCTCTTAGAATGAATCTAACTATTCCGGGGATTGTTCTGCCC
ACTTTATTATCTTCAAAACTATTTGGAGTCCCCTGGATTTTTTATATCAC
TACAGTTGTAGTCATGACTACAGGAACTCTCTTATTGATGTGGATCGGTG
AACAGATCTCCGATAAGGGGATTGGGAACGGGATAAGTTTAATTATCGCC
CTTGGAATTCTATCCTCATTTCCTTCTGTATTGGGATCTATTGTTAATAA
GTTAAATTTAGGATCTCAAGACTCCTCTGATTTGGGTCTAATTTCAATTT
TAATCCTTGCTCTTGTTTTTGTTTTTGTTCTGATTACTACGATTTTGATT
ATCGAGGGAGTGAGAAAAATCCCTGTGCAATATGCTCGAAGGGTAATTGG
AAGAAGAGAAGTCCCCGGTGGAGGGTCCTATCTTCCTTTAAAAGTTAACT
ATGCTGGCGTCATTCCTGTGATTTTTGCTTCCTCGCTACTGATGTTCCCA
GCAACTATAGGACAGTTTATTGCGTCAGAGTCTTCTTGGATGAAGCGTAT
AGCAGCTTTACTTGCTCCAGGCAGTTTAGTTTATTCTATATGTTATGTGT
TGCTCATTATATTTTTTACATACTTTTGGACAGCCACACAATTTCATCCA
GAACAAATTGCTTCTGAAATGAAAAAAAATAATGCCTTTATTCCTGGCAT
ACGTCAGGGCAAGCCTACGCAACATTACTTAGAGTATACAATGAATCGTG
TGACCCTTTTAGGAGCGTTGTTCTTAGCGGCGATCGCGATATTACCTTCA
CTTTTAGGTTGTCTGCTTCGTGTGGATTCTAATGTAAGCTATTTCTTAGG
CGGTACTGCAATGCTTATCGTCGTAGGGGTCGTTTTAGATACAATGAAGC
AGGTTGATGCCTTTTTGTTAATGCGTCGCTACGATAGCGTGCTGAAAACA
GATCGGACGAAAGGAAGACATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy