Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR503 IGR494 IGR500 IGR504 IGR492 IGR502 IGR499 IGR495 IGR496 IGR498 IGR501 IGR493 IGR497 IGR491 rl24, - CPn0636 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl24, - CPn0636 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl14, - CPn0637 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl15, - CPn0630 rl15, - CPn0630 rl24, - CPn0636
* Calculated from Protein Sequence

Gene ID: CPn0628

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs13  

Definition:
30S ribosomal protein S13

Gene Start:
720428

Gene Stop:
720060

Gene Length:
369

Molecular Weight*:
13949

pI*:
11.50

Net Charge*:
18.47

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The S13 protein is involved in the binding of f-MET-tRNA.

See Gu et al., J.Bact.177:2594 (1995) and Tan et al., J. Bact. 175: 7150 (1993).

Blast Summary:  PSI-Blast Search
CPn0628 is orthologously related to CT509: residues 1-122 of CPn0628 are 89% similar to residues 1-122 of CT509, a predicted conserved hypothetical protein from C. trachomatis. CPn0628 is similar to MP0642 in M. pneumoniae, MG175 in M. genitalium, UU255 in U. urealyticum and TP0210 in T. pallidum, all predicted ribosomal proteins.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0099
COG name: Ribosomal protein S13
Functional Class:  J
The phylogenetic pattern of COG0099 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 109 (E-value = 1e-49) place CPn0628 in the Ribosomal_S13 family which is described as Ribosomal protein S13/S18 (PF00416)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
122

PDB Hit:


Gene Protein Sequence:
MPRIIGIDIPAKKKLKISLTYIYGIGSARSDEIIKKLKLDPEARASELTE
EEVGRLNSLLQSEYTVEGDLRRRVQSDIKRLIAIHSYRGQRHRLSLPVRG
QRTKTNSRTRKGKRKTVAGKKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCACGCATCATTGGAATTGATATTCCTGCAAAGAAAAAGTTAAAAAT
AAGTCTGACATATATTTATGGAATAGGATCAGCTCGTTCTGATGAAATCA
TTAAAAAGTTGAAGTTAGATCCTGAGGCAAGAGCCTCTGAATTAACTGAA
GAAGAAGTAGGACGACTGAACTCTCTGCTACAATCAGAATATACCGTAGA
AGGGGATTTGCGACGTCGTGTTCAATCGGATATCAAAAGATTGATCGCCA
TCCATTCTTATCGAGGTCAGAGACATAGACTTTCTTTACCAGTAAGAGGA
CAACGTACAAAAACTAATTCTCGTACTCGAAAAGGTAAAAGAAAAACAGT
CGCAGGTAAGAAGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy