Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR503 IGR494 IGR500 IGR492 IGR502 IGR499 IGR495 IGR496 IGR498 IGR501 IGR493 IGR497 IGR491 rl24, - CPn0636 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl24, - CPn0636 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rs8, - CPn0634 rl17, - CPn0625 rs5, - CPn0631 rl5, - CPn0635 rl6, - CPn0633 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl15, - CPn0630 rl15, - CPn0630 rl24, - CPn0636
* Calculated from Protein Sequence

Gene ID: CPn0627

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs11  

Definition:
30S ribosomal protein S11

Gene Start:
720038

Gene Stop:
719637

Gene Length:
402

Molecular Weight*:
13934

pI*:
11.60

Net Charge*:
16.37

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The S11 protein is believed to select the
correct tRNA during polypeptide biosynthesis.

See Tan et al. J.Bact.175:7150 (1993).

Blast Summary:  PSI-Blast Search
CPn0627 is similar to TP0211in T. pallidum, UU256
in U. urealyticum and MG176 in M. genitalium.

CPn0627 is orthologously related to CT508:
residues 1-133 are 92% similar to residues 1-132
of CT508.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0100
COG name: Ribosomal protein S11
Functional Class:  J
The phylogenetic pattern of COG0100 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 23 to 132 (E-value = 2.4e-54) place CPn0627 in the Ribosomal_S11 family which is described as Ribosomal protein S11 (PF00411)

PDB Hit:


Gene Protein Sequence:
LVKNQAQAKKSVKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNVISWAS
AGKVGYSGSRKSSAFAATVAAQDAAKTAMNSGLKEVEVCLKGTGAGRESA
VRALISAGLVVSVIRDETPVPHNGCRPRKRRRV$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTTAAAAATCAAGCGCAGGCAAAAAAGAGCGTAAAAAGAAAACAACT
AAAAAATATTCCTTCAGGTGTTGTGCATGTTAAAGCAACCTTTAACAATA
CAATAGTATCTATAACAGATCCTGCTGGTAATGTGATTTCTTGGGCATCA
GCAGGTAAAGTAGGATATTCTGGTTCAAGAAAATCTTCAGCCTTTGCTGC
CACTGTAGCAGCTCAAGACGCTGCTAAAACTGCCATGAACTCTGGTTTAA
AGGAAGTAGAGGTTTGTTTGAAGGGTACTGGAGCTGGGAGAGAGTCTGCT
GTTCGTGCTTTGATATCTGCTGGTTTGGTAGTTTCTGTAATCCGTGATGA
AACTCCTGTTCCTCATAATGGTTGCCGGCCAAGAAAAAGGCGCAGAGTGT
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy