Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR500 IGR492 IGR499 IGR495 IGR496 IGR498 IGR501 IGR493 IGR497 IGR490 IGR491 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl17, - CPn0625 rs5, - CPn0631 ruvC, - CPn0621 rl6, - CPn0633 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl17, - CPn0625 rs5, - CPn0631 ruvC, - CPn0621 rl6, - CPn0633 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs13, - CPn0628 rl18, - CPn0632 rs8, - CPn0634 rs11, - CPn0627 rl17, - CPn0625 rs5, - CPn0631 rl6, - CPn0633 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl15, - CPn0630 rl15, - CPn0630 ruvC, - CPn0621
* Calculated from Protein Sequence

Gene ID: CPn0626

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoA  

Definition:
RNA polymerase alpha subunit

Gene Start:
719616

Gene Stop:
718492

Gene Length:
1125

Molecular Weight*:
41850

pI*:
4.90

Net Charge*:
-12.61

EC:
2.7.7.6  

Functional Class:
transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
The DNA-dependent RNA polymerase consists of the sigma factor and the core enzyme which is composed of
2 alpha subunits, 1 beta subunit, and 1 beta' subunit. See CPn0081: rpoB, beta subunit; CPn0082: rpoC, beta' subunit' CPn0756: rpoD, sigma-66; CPn0771: rpoN, sigma-54.


Blast Summary:  PSI-Blast Search
CPn0626 is orthologously related to CT507: residues 1-374 of CPn0626 are 84% similar to residues 1-377 of CT507, a DNA-directed RNA polymerase alpha subunit, rpoA.
CPn0626 is also similar to TP0212, UU257, MG177.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0202
COG name: DNA-dependent RNA polymerase alpha subunit
Functional Class:  K
The phylogenetic pattern of COG0202 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 30 to 255 (E-value = 9.7e-16) place CPn0626 in the RNA_pol_L family which is described as RNA polymerase Rpb3/Rpb11 dimerisation domain (PF01193)
Residues 66 to 200 (E-value = 3.9e-15) place CPn0626 in the RNA_pol_A_bac family which is described as RNA polymerase Rpb3/RpoA insert domain (PF01000)
Residues 270 to 337 (E-value = 1.3e-33) place CPn0626 in the RNA_pol_A_CTD family which is described as Bacterial RNA polymerase, alpha chain C terminal domain (PF03118)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
57  
74
non-globular  
237  
319

PDB Hit:


Gene Protein Sequence:
MSDNAHNLLYDKFELPEAVKMLPVEGLPIDKHARFIAEPLERGMGHTLGN
ALRRALLIGLEAPAIISFAMTGVLHEYMAIEGVIEDVTNIILNLKGALLK
KYPMQDSSLGRTTQVLKASISIDASDLAAANGQKEVTLQDLLQEGDFEAV
NPDQVIFTVTQPIQLEVVLRIAFGRGYTPSERIVLEDKGVYEIVLDAAFS
PVTLVNYFVEDTRVGQDTDFDRLVLIVETDGRVTPKEALAFSTQILTKHF
SIFENMDEKKIVFEEAISIEKENKDDILHKLILGINEIELSVRSTNCLSN
ANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKEMKLELGMDLTQFG
VGLDNVKEKMKWYAEKIRAKNTKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGATAACGCACACAATTTACTTTATGATAAGTTTGAACTGCCTGA
AGCAGTTAAAATGTTGCCTGTTGAAGGGCTTCCAATAGACAAACATGCTC
GCTTCATTGCTGAGCCTCTAGAAAGAGGAATGGGCCACACTTTAGGAAAT
GCTCTAAGACGTGCTTTGCTTATTGGTTTAGAAGCTCCAGCTATTATCTC
GTTTGCTATGACAGGCGTACTTCATGAATATATGGCAATCGAAGGGGTTA
TTGAGGATGTAACTAACATCATTCTGAATTTAAAAGGTGCCCTATTAAAA
AAGTACCCCATGCAGGATAGTTCTTTAGGAAGAACCACTCAGGTCTTAAA
AGCTTCAATTTCTATAGATGCTTCCGATTTAGCCGCAGCTAATGGACAAA
AAGAAGTGACTCTACAAGATCTATTGCAAGAAGGGGACTTTGAAGCCGTT
AACCCAGATCAAGTCATTTTTACTGTTACTCAACCCATACAGTTGGAAGT
CGTTCTACGAATTGCTTTTGGTAGGGGATATACACCTTCTGAAAGGATTG
TTTTGGAAGATAAGGGTGTTTATGAAATCGTTTTGGATGCAGCCTTTTCT
CCAGTCACTTTAGTCAACTACTTTGTAGAAGATACACGGGTGGGTCAGGA
TACAGATTTTGACCGTTTAGTTTTAATAGTTGAAACAGATGGAAGAGTGA
CTCCGAAAGAAGCTCTGGCTTTTTCAACTCAAATTTTGACTAAACATTTT
TCCATTTTTGAAAATATGGATGAGAAGAAAATCGTATTTGAAGAAGCTAT
TTCTATTGAGAAAGAAAACAAAGATGATATTCTTCATAAGTTAATTTTAG
GAATTAATGAAATAGAACTCTCAGTCAGATCAACAAATTGTTTGTCTAAT
GCAAATATTGAGACTATTGGCGAACTTGTTATTATGCCTGAACCTCGATT
GCTACAATTCAGAAATTTTGGAAAGAAATCACTGTGTGAGATCAAGAATA
AATTGAAAGAAATGAAGCTTGAATTAGGAATGGACCTAACGCAATTTGGC
GTAGGTTTAGATAACGTAAAAGAAAAAATGAAGTGGTATGCCGAAAAGAT
TCGGGCTAAAAATACAAAGGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy