Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR500 IGR492 IGR499 IGR495 IGR496 IGR498 IGR493 IGR497 IGR488 IGR490 IGR491 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 rs5, - CPn0631 ruvC, - CPn0621 rl6, - CPn0633 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs13, - CPn0628 rl18, - CPn0632 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 rs5, - CPn0631 ruvC, - CPn0621 rl6, - CPn0633 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 rs5, - CPn0631 ruvC, - CPn0621 rl6, - CPn0633 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl15, - CPn0630 rl15, - CPn0630 rl18, - CPn0632
* Calculated from Protein Sequence

Gene ID: CPn0625

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl17  

Definition:
50S ribosomal protein L17

Gene Start:
718485

Gene Stop:
718057

Gene Length:
429

Molecular Weight*:
16384

pI*:
11.50

Net Charge*:
20.85

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0625 is orthologously related to CT506: residues 1-141 of CPn0625 are 86% similar to residues 1-141 of CT506, a predicted 50S ribosomal protein L17 from C. trachomatis.
CPn0625 is also similar to UU258, TP0213, both 50S ribosomal protein L17.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0203
COG name: Ribosomal protein L17
Functional Class:  J
The phylogenetic pattern of COG0203 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 20 to 140 (E-value = 2.3e-69) place CPn0625 in the Ribosomal_L17 family which is described as Ribosomal protein L17 (PF01196)

PDB Hit:


Gene Protein Sequence:
MQHARKKFRVGRTSSHNRCMLANMLKSLIHYERIETTLPKAKELRRHADK
MITLAKKNSLAARRIAIGRLMVRYNKLTSKEARQAKGGDTSVYNVDRLVV
NKLFDELGNRFVERKGGYTRILKLQNRIGDNAQKCIIEFLAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACACGCTAGAAAAAAATTTAGAGTTGGTCGTACTTCCTCGCATAA
TCGCTGTATGTTAGCTAACATGTTAAAGTCTCTAATTCATTATGAAAGAA
TTGAGACTACTTTGCCTAAAGCTAAAGAACTACGCCGACATGCTGATAAA
ATGATTACCTTAGCTAAAAAAAACTCCTTAGCAGCACGACGTATAGCTAT
TGGACGGCTTATGGTCAGATACAATAAATTAACAAGCAAAGAAGCTCGAC
AAGCTAAAGGTGGAGACACCTCTGTATATAATGTCGATCGTTTGGTTGTG
AATAAGTTATTCGATGAGTTGGGGAATCGTTTTGTAGAAAGAAAAGGTGG
TTACACACGTATTCTAAAACTGCAAAATAGAATTGGTGATAATGCTCAAA
AGTGTATTATAGAGTTTTTAGCTAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy