Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR492 IGR495 IGR496 IGR498 IGR493 IGR497 IGR488 IGR490 IGR491 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 rs5, - CPn0631 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 lplA, - CPn0618 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 rs5, - CPn0631 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 lplA, - CPn0618 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 rl15, - CPn0630 rs5, - CPn0631 rl15, - CPn0630 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0624

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gapA  

Definition:
glyceraldehyde 3-phosphate dehydrogenase

Gene Start:
718015

Gene Stop:
717008

Gene Length:
1008

Molecular Weight*:
36824

pI*:
6.70

Net Charge*:
-1.11

EC:
1.2.1.12  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis /Gluconeogenesis Energy Metabolism; Carbon fixation

Comment:
See Gu et al. J.Bact.177:2594 (1995).

Blast Summary:  PSI-Blast Search
CPn0624 is similar to TP0844 in T. pallidum and
to MG301 in M. genitalium, both predicted G3P
dehydrogenases.

CPn0624 is orthologously related to CT505 and
they share 74% similarity.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0057
COG name: Glyceraldehyde-3-phosphate dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0057 is amtkYqvCEBrhUJgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 151 (E-value = 1.3e-93) place CPn0624 in the Gp_dh_N family which is described as Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044)
Residues 152 to 313 (E-value = 8e-118) place CPn0624 in the Gp_dh_C family which is described as Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain (PF02800)

PDB Hit:


Gene Protein Sequence:
MKVVINGFGRIGRLVLRQILKRNSSVEVLAINDLVPGDALTYLFKFDSTH
GRFPEDVRCEADHLIVGKRKIQFLSERNVQNLPWKDLGVDLVIECTGLFT
KKEDAEKHIQAGAKRVLISAPGKGDIPTFVMGVNHKTFNPEKDFVISNAS
CTTNCLAPIAKVLLDNFGITEGLMTTVHAATATQLVVDGPSKKDWRGGRG
CLQNIIPASTGAAKAVTLCLPELKGKLTGMAFRVPIEDVSVVDLTVRLDK
STTYDDICKAMKQASETDLKGILDYTDEQVVSSDFIGSEYSSIFDALAGI
ALNDRFFKLVAWYDNETGYATRIVDLLEYVEKNSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTGTAATTAATGGTTTCGGGCGAATTGGTCGTTTAGTTTTAAG
ACAAATCTTAAAGAGAAACTCTTCAGTAGAAGTCCTCGCCATTAATGATC
TTGTTCCTGGGGATGCGCTTACCTATCTATTTAAATTCGACTCTACACAT
GGACGTTTTCCTGAGGATGTACGTTGTGAAGCGGACCACCTCATCGTTGG
GAAGAGAAAAATTCAATTTTTATCTGAACGCAATGTTCAAAATCTTCCTT
GGAAAGATTTAGGGGTTGATCTCGTTATTGAATGTACAGGATTGTTCACA
AAAAAAGAAGATGCTGAGAAGCATATTCAAGCTGGAGCGAAACGAGTCTT
AATCTCTGCTCCTGGAAAAGGTGATATTCCTACTTTCGTTATGGGAGTGA
ACCATAAGACTTTCAATCCAGAAAAAGACTTTGTTATATCGAATGCTTCT
TGCACTACGAATTGTTTAGCTCCTATTGCTAAAGTTTTACTAGATAATTT
CGGAATTACAGAAGGTTTGATGACAACAGTTCATGCTGCTACTGCTACTC
AACTAGTTGTTGACGGACCTTCTAAGAAAGATTGGAGAGGAGGTCGTGGA
TGTTTACAAAATATTATTCCCGCCTCAACCGGAGCTGCAAAAGCTGTAAC
TCTATGTCTTCCCGAGTTAAAGGGAAAATTAACAGGAATGGCTTTTCGGG
TTCCTATCGAAGACGTGTCTGTAGTTGACTTGACCGTCAGGTTAGATAAG
TCTACGACATACGATGACATTTGCAAAGCTATGAAACAGGCTTCAGAAAC
TGATTTAAAAGGCATTTTAGATTATACAGATGAGCAGGTAGTTTCTTCAG
ATTTTATAGGATCTGAGTACTCCTCGATATTCGATGCTCTAGCTGGTATC
GCTTTGAATGATCGGTTCTTCAAGTTAGTTGCGTGGTATGATAACGAAAC
AGGATATGCCACGCGTATAGTAGACTTATTAGAGTATGTAGAAAAAAACT
CTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy