Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR492 IGR495 IGR496 IGR493 IGR497 IGR488 IGR490 IGR491 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 gidA, - CPn0617 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 gidA, - CPn0617 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 secY, - CPn0629 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0623

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
716993

Gene Stop:
716160

Gene Length:
834

Molecular Weight*:
31013

pI*:
4.70

Net Charge*:
-15.09

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0623 is orthologously related to CT504: residues 1-270 of CPn0623 are 55% similar to residues 1-278 of CT504, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
70  
277

PDB Hit:


Gene Protein Sequence:
VYFTRDPVIETVITSREGYKLSVRNTKHFSQDPFMVEAIEVISLGNICFF
RNCDHSKPFLVPAGDYEVMEVRDTKINLKAVGLDRGVKIAGGREALIKLT
KSTPLPVIDEKPLADSPEEGTEPTSPSKKEKKEARKDSFKGEKWKEKKKL
SRRRNHKEIAEVTGASQEILDTVKEELWEESQENEIVEQKKFSLLPPPAK
LISEVISQTVVDPVVTSADLNESLQALVRESSDLINALLSADDAIHFPET
EEEPTSASFEESSAMFFPETSSATEEE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTATTTTACAAGAGACCCCGTCATAGAAACTGTAATTACCTCTCGAGA
GGGGTATAAGTTGTCGGTAAGGAATACAAAGCATTTTTCACAAGATCCTT
TTATGGTTGAAGCTATAGAAGTGATCTCTTTAGGAAATATTTGTTTTTTC
CGTAACTGTGATCATAGTAAACCTTTTTTAGTCCCTGCCGGAGACTATGA
GGTTATGGAAGTCCGTGATACTAAAATCAATTTGAAAGCTGTCGGTTTAG
ATCGTGGAGTGAAAATTGCTGGTGGTAGAGAAGCTCTAATCAAGTTGACC
AAATCGACTCCGCTTCCTGTGATTGATGAGAAGCCTCTAGCTGATAGCCC
AGAGGAAGGAACCGAGCCTACATCTCCTAGTAAAAAGGAAAAGAAAGAGG
CAAGGAAAGATTCCTTTAAAGGGGAGAAGTGGAAGGAAAAGAAAAAGCTC
AGCCGTCGTAGAAATCATAAAGAGATTGCTGAAGTAACTGGAGCATCTCA
AGAAATCTTGGATACTGTTAAGGAAGAGCTTTGGGAAGAATCTCAAGAAA
ATGAGATTGTTGAACAGAAGAAGTTTTCTTTACTTCCACCCCCAGCAAAG
TTGATCTCCGAAGTTATCTCTCAAACTGTTGTAGATCCAGTAGTTACTTC
TGCGGATCTTAACGAGTCGTTACAAGCTTTGGTTCGTGAGAGCAGCGATC
TCATCAATGCTTTGCTATCGGCAGATGATGCTATACATTTTCCTGAGACA
GAAGAGGAACCTACCTCAGCTTCTTTTGAAGAGTCTTCTGCAATGTTCTT
CCCCGAAACATCTTCTGCTACAGAAGAAGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy