Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR492 IGR495 IGR496 IGR493 IGR488 IGR490 IGR487 IGR491 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 gidA, - CPn0617 rs13, - CPn0628 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 gidA, - CPn0617 rs11, - CPn0627 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 rs13, - CPn0628 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0622

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
715752

Gene Stop:
714790

Gene Length:
963

Molecular Weight*:
37385

pI*:
6.70

Net Charge*:
-2.21

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Conserved hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0622 is orthologously related to CT503: residues 3-178 of CPn0622 are 46% similar to residues 3-181 of CT503, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1196
COG name: Chromosome segregation ATPases
Functional Class:  D
The phylogenetic pattern of COG1196 is am-kYqvc-br---gpol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
38
coil-coil  
77  
282

PDB Hit:


Gene Protein Sequence:
VRLLSILKLHLFSLRSSSSLSPHYYHSCSRSMLHLLCRWKDADIMEWQQI
CNILSGVCSRMSGKLVSLQKETQDSCHQEHERIHLQYREQLSALEEEYRR
REEAKNQDLEKLQQENTWLQNRLAEKLQQIRHQSDIIDEIKKELLQSVQR
TEISEGRRLCYEHKIKQLEEQLQRYVSQHGAPSIEIEEDKSSAAYAEINR
LKKSLIDLQQEKDIYIKTYHSEIAKLREKLQRQEGAQTSSEVCSIEKLTE
VQTDLAEKKKAIALLQDIVEDQYCQLRDLHKEKGMAMPSNTKLDHLKGLL
GKEPESEVDVVFSESKSLGS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGGCTCTTATCTATACTTAAGCTGCATCTCTTCTCGCTACGATCTTC
CAGTTCATTATCCCCTCACTATTATCATTCATGCTCCCGTTCCATGCTTC
ATTTGCTTTGTCGCTGGAAAGATGCTGATATTATGGAATGGCAGCAGATT
TGCAATATTCTTTCAGGAGTCTGTAGCAGAATGAGTGGAAAGTTGGTTTC
TTTGCAGAAGGAAACCCAAGACTCTTGTCATCAGGAGCATGAACGTATTC
ACTTACAGTATCGGGAACAGCTATCTGCTTTGGAAGAAGAATATCGCCGT
CGTGAAGAAGCTAAAAATCAAGATTTAGAAAAGTTACAACAAGAAAATAC
CTGGTTGCAAAATCGCCTTGCTGAGAAATTACAACAAATTCGACACCAAA
GTGATATTATCGACGAGATAAAAAAAGAACTGCTTCAAAGTGTACAGCGA
ACAGAAATTAGTGAAGGGCGTCGTTTATGCTATGAGCATAAAATTAAACA
GCTGGAAGAACAACTACAGCGTTATGTTTCGCAACACGGAGCCCCCTCTA
TAGAGATAGAAGAAGACAAATCTTCAGCCGCATATGCAGAGATCAACCGT
TTGAAGAAAAGTCTTATAGATTTGCAACAAGAAAAAGATATTTATATAAA
AACATATCATTCAGAGATTGCTAAGTTAAGAGAAAAATTACAGCGACAAG
AAGGAGCTCAAACTAGCTCTGAGGTTTGTTCTATTGAGAAGTTAACAGAG
GTGCAAACCGATCTAGCTGAAAAAAAGAAAGCCATAGCCTTACTCCAAGA
TATTGTTGAGGATCAATATTGTCAGCTTCGAGATCTACATAAAGAGAAAG
GTATGGCTATGCCTTCAAATACAAAGTTAGATCATTTGAAAGGACTTTTA
GGCAAAGAACCTGAGAGTGAAGTAGACGTAGTATTCTCAGAATCTAAATC
TTTAGGGAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy