Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR492 IGR493 IGR488 IGR490 IGR487 IGR491 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 dnaB, - CPn0616 gidA, - CPn0617 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 dnaB, - CPn0616 gidA, - CPn0617 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0621

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ruvC  

Definition:
Holliday junction endonuclease

Gene Start:
714647

Gene Stop:
714141

Gene Length:
507

Molecular Weight*:
18356

pI*:
9.30

Net Charge*:
3.86

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
This nuclease, also called a resolvase, cleaves
cruciform structures
in supercoiled DNA. It is a crossover junction
endonuclease,
typically a homodimer.

Blast Summary:  PSI-Blast Search
CPn0621 is similar to TP0517, a predicted Holliday
junction nuclease subunit C in T. pallidum. Residues
4-162 are 40% similar to residues 18-173 of TP0517.

CPn0621 is orthologusly related to CT502:
residues 1-160 are 60% similar to that of CT502.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0817
COG name: Holliday junction endodeoxyribonuclease RuvC
Functional Class:  L
The phylogenetic pattern of COG0817 is ------vce-rhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 156 (E-value = 3.8e-100) place CPn0621 in the RuvC family which is described as Crossover junction endodeoxyribonuclease RuvC (PF02075)

PDB Hit:


Gene Protein Sequence:
VSELIIGVDPGTIVAGYAIIAVEQRYQLRPYSYGAIRLSSDMPLPMRYKT
LFEQLSGVLDDTQPNAMVLETQFVNKNPQSTMKLAMARGIVLLAAAQRDI
LIFEYAPNVAKKAVVGKGHASKRQVQVMVSKILNVPEVLHPSNEDIADAF
ALAICHTHVARSPLCGVR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCAGAACTGATTATAGGTGTGGATCCAGGAACGATAGTCGCAGGATA
TGCCATCATTGCAGTGGAACAGCGCTATCAATTACGTCCTTATAGTTATG
GTGCCATTCGTTTATCTTCCGACATGCCACTGCCTATGCGCTATAAGACT
TTGTTTGAGCAACTCTCAGGAGTATTAGATGATACGCAACCTAATGCTAT
GGTCCTAGAAACGCAATTTGTAAATAAGAATCCTCAAAGTACTATGAAAT
TAGCTATGGCACGAGGAATCGTTTTATTGGCTGCAGCTCAGCGTGATATC
CTCATTTTTGAATATGCCCCAAATGTTGCTAAGAAAGCAGTAGTCGGTAA
GGGTCATGCAAGTAAAAGACAGGTCCAGGTGATGGTAAGCAAGATTCTAA
ATGTTCCCGAAGTTTTGCACCCTTCGAATGAAGATATTGCTGATGCCTTT
GCACTTGCTATATGTCATACTCATGTAGCGCGTAGCCCTCTTTGTGGAGT
GAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy