Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 IGR489 IGR494 IGR492 IGR493 IGR488 IGR490 IGR487 IGR491 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 dnaB, - CPn0616 gidA, - CPn0617 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 rpoA, - CPn0626 rl17, - CPn0625 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0620

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ruvA  

Definition:
Holliday junction DNA helicase RUVA

Gene Start:
714139

Gene Stop:
713516

Gene Length:
624

Molecular Weight*:
22954

pI*:
6.90

Net Charge*:
-0.55

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
RUVAB is a helicase complex of RUVA (CPn0620) and
RUVB (CPn0390), with the RUVA component, a homoteramer typically,
promoting ATPase activity of RUVB. The helicase complex mediates Holliday
junction migration ostensibly by localized reannealing.

Blast Summary:  PSI-Blast Search
Weak similarities to TP0543 in T. pallidum, UU449
in U. urealyticum and MG358 in M. genitalium.
All three are predicted Holliday junction DNA
helicase subunit A.

CPn0620 is orthologously similar to CT501 and
they share 55% similarity.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0632
COG name: Holliday junction DNA helicase subunit
Functional Class:  L
The phylogenetic pattern of COG0632 is ------vcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 63 (E-value = 8.8e-27) place CPn0620 in the RuvA family which is described as RuvA N terminal domain (PF01330)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
80  
97

PDB Hit:


Gene Protein Sequence:
MYDYIRGTLTYVHTGAIVIECQGIGYHIAITERWAIECIRALHQDFLVFT
HVIFRETEHLLYGFHSREERECFRILISFSGIGPKLALAILNALPLKVLC
SVVRSEDIRALASVSGIGKKTAEKLMVELKQKLPDLLPLDSRVETSQTHT
TSSCLEEGIQALAALGYSKIAAERMIAEAIKDLPEGSSLTDILPIALKKN
FSGVNKD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACGACTATATTCGTGGAACACTGACCTATGTGCATACTGGTGCAAT
TGTTATAGAATGCCAAGGTATTGGCTACCATATTGCTATTACAGAACGTT
GGGCAATAGAATGCATCAGGGCTTTACATCAAGACTTTCTCGTCTTCACT
CATGTGATATTCCGTGAAACGGAACACTTGCTCTATGGGTTTCATTCTCG
AGAAGAGCGAGAGTGTTTCCGTATTTTAATTTCTTTTTCTGGAATAGGAC
CTAAGCTAGCCCTCGCGATTCTTAATGCGCTACCTTTAAAGGTACTATGT
TCTGTAGTCCGATCTGAAGATATTCGTGCTTTAGCTTCCGTATCGGGAAT
TGGGAAAAAAACTGCTGAAAAACTCATGGTTGAGCTTAAACAAAAATTAC
CAGATTTACTTCCTCTAGACTCGAGAGTGGAGACCAGCCAAACACATACC
ACCTCTTCTTGCTTGGAGGAAGGCATTCAGGCTTTAGCAGCTTTGGGTTA
TTCAAAAATTGCTGCTGAACGTATGATTGCCGAAGCAATCAAAGATCTCC
CTGAGGGATCTTCTTTAACAGATATCCTTCCTATCGCTCTGAAAAAGAAT
TTTTCAGGAGTGAACAAGGACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy