Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 tRNA_Ser_2 IGR489 IGR492 IGR493 IGR488 IGR490 IGR487 IGR491 IGR486 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 dnaB, - CPn0616 gidA, - CPn0617 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 dnaB, - CPn0616 gidA, - CPn0617 rl17, - CPn0625 ndk, - CPn0619 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0619

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ndk  

Definition:
nucleoside diphosphate kinase

Gene Start:
713444

Gene Stop:
713010

Gene Length:
435

Molecular Weight*:
15626

pI*:
5.30

Net Charge*:
-4.04

EC:
2.7.4.6  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; nucleotide and nucleoside interconversions  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
This enzyme catalyzes the synthesis of nucleoside triphosphates
other than ATP. ATP is added to the nucleoside diphosphate.
The molecule is known in some cases to be a homotetramer.



Blast Summary:  PSI-Blast Search
CPn0619 is orthologously related to CT500, a predicted nucleoside diphosphate kinase:
residues 1-139 are 81% similar to CT500. CPn0619 is also similar to
TP1010, a predicted nucleoside diphosphate kinase.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0105
COG name: Nucleoside diphosphate kinase
Functional Class: F
The phylogenetic pattern of COG0105 is amtkyq-cebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 139 (E-value = 1.5e-71) place CPn0619 in the NDK family which is described as Nucleoside diphosphate kinase (PF00334)

PDB Hit:


Gene Protein Sequence:
MEQTLSIIKPDSVSKAHIGEILSIFEQSGLRIAAMKMMHLSQTEAEGFYF
VHRERPFFQELVDFMVSGPVVVLVLEGANAVSRNRELMGATNPAEAASGT
IRAKFGESIGVNAVHGSDTLENAAVEIAYFFSKIEVVNASKPLV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACAAACGCTATCCATTATTAAACCAGATTCTGTTAGCAAAGCCCA
TATCGGAGAGATCTTATCTATTTTTGAACAATCTGGATTACGTATAGCTG
CTATGAAAATGATGCACCTATCCCAAACTGAAGCCGAAGGGTTTTATTTT
GTGCATAGAGAGCGTCCTTTTTTCCAAGAACTTGTTGATTTTATGGTCTC
AGGCCCTGTTGTAGTTTTAGTATTGGAAGGGGCAAATGCCGTTTCCCGAA
ATCGTGAACTTATGGGAGCTACAAATCCTGCAGAAGCTGCTTCAGGAACC
ATTCGAGCTAAGTTTGGGGAATCTATAGGCGTGAATGCTGTTCATGGATC
TGATACTTTAGAAAATGCTGCTGTCGAAATCGCTTACTTCTTCAGTAAGA
TAGAAGTTGTTAACGCTTCGAAACCTCTCGTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy